SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SMAR011882-PA from Strigamia maritima 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SMAR011882-PA
Domain Number 1 Region: 305-584
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.19e-78
Family Protein kinases, catalytic subunit 0.0000319
Further Details:      
 
Domain Number 2 Region: 1461-1646
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.76e-22
Family Laminin G-like module 0.022
Further Details:      
 
Domain Number 3 Region: 1967-2127
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.61e-18
Family Laminin G-like module 0.0048
Further Details:      
 
Domain Number 4 Region: 1659-1829
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000000000416
Family Laminin G-like module 0.0058
Further Details:      
 
Domain Number 5 Region: 1147-1190
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000474
Family EGF-type module 0.006
Further Details:      
 
Domain Number 6 Region: 2223-2260
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000712
Family EGF-type module 0.005
Further Details:      
 
Domain Number 7 Region: 1185-1227
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000785
Family EGF-type module 0.0046
Further Details:      
 
Domain Number 8 Region: 2343-2386
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000332
Family EGF-type module 0.0049
Further Details:      
 
Domain Number 9 Region: 899-960
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.000000000897
Family SAM (sterile alpha motif) domain 0.011
Further Details:      
 
Domain Number 10 Region: 1223-1267
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000274
Family EGF-type module 0.0045
Further Details:      
 
Domain Number 11 Region: 1262-1305
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000419
Family EGF-type module 0.0097
Further Details:      
 
Domain Number 12 Region: 1360-1402
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000044
Family EGF-type module 0.0046
Further Details:      
 
Domain Number 13 Region: 1000-1034
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000567
Family EGF-type module 0.0056
Further Details:      
 
Domain Number 14 Region: 2422-2474
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000124
Family EGF-type module 0.072
Further Details:      
 
Domain Number 15 Region: 2292-2420
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000204
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 16 Region: 1397-1434
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000141
Family EGF-type module 0.0091
Further Details:      
 
Domain Number 17 Region: 1037-1078
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000159
Family EGF-type module 0.0051
Further Details:      
 
Domain Number 18 Region: 2265-2303
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000221
Family EGF-type module 0.013
Further Details:      
 
Weak hits

Sequence:  SMAR011882-PA
Domain Number - Region: 1074-1111
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000125
Family EGF-type module 0.037
Further Details:      
 
Domain Number - Region: 2178-2225
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000193
Family EGF-type module 0.033
Further Details:      
 
Domain Number - Region: 1300-1364
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000227
Family EGF-type module 0.011
Further Details:      
 
Domain Number - Region: 1112-1159
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00042
Family EGF-type module 0.019
Further Details:      
 
Domain Number - Region: 962-998
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00136
Family EGF-type module 0.0092
Further Details:      
 
Domain Number - Region: 2147-2189
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00235
Family EGF-type module 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SMAR011882-PA
Sequence length 2540
Comment pep:novel scaffold:Smar1:JH432107:139027:152458:-1 gene:SMAR011882 transcript:SMAR011882-RA description:""
Sequence
MICLCGRIYKDKFVESGHTDKESLEKAIHWYRKGFEVQPNEYAGINLATLLVVSGKEFAR
SPELQHIGMVLNNLIGRKGSLSSLQDYWDVATFFEISVLAEDYGKAIQAAECMFKLKPPI
WYLTSTIGNIRLITMFPKKNDDSETNPEEKMFSFWMDYFVEATKSAAWDIIRFPVLVFEP
TKVYMPTYVTVHTGAEEKSLDINNICLDELKNKCRQVHKWHFNASMIKSVSLYKRDERCL
CLYVHQNSDDFQMFFPSKMYRQRFYDLVLEITADQEGMVTDLGSSLSSEPIHYEYDLDDQ
LKRVMLGKGTYGVVYAARDLDTQVRIAIKEVPEKNLGDVQPLHEEIKLHSQLRHRNIVQY
LGSVSDNGFFKIFMEQVPGGSLSALLRSKWGPLKEGTIAYYTKQILEGLKYLHNQKIVHR
DIKGDNVLVNTYSGVVKISDFGTSKRLAGICPCTETFTGTLQYMAPEVIDKGQRGYGAPA
DIWSLGCTAVEMASGKPPFIELGSAQAAMFKVGMYKIHPEIPESMSDKATQFILKCFEPN
PDERSGAAELLDDVFLQEFVRKKKSSRSNAIPDFHRSISVPAERISSLEKHERYGHLSSF
TDEHKSEDGIFVRRFSSGVTSPLVEDQEQDCFYLLKMDSQRRDTLVRIISADEEKICDIW
LSNLQQQMDSSILTKNHLLVLMEGLRDYIPEQNKMPIQKALARLREEMESENTMNQIQLG
LCLFQDAVNFVLRQHNIKPHWMFALDNLVRSAVHAAITVLSPGANLAGREHRGIIGVEDE
GSASAASTINSVKSQTNLGNEFRNSKLVQDLLETNESLKLENIRLLQEMVDVQKSYHDLL
KQSLTEKKCQVNLLSTKLQNGRTRLDSALFLSNESIASPVEISELLQINNFIATALQEVD
SSLIQWLENLQLDQDSITKFVNEGFLLEDVLAVMSRDDLRHLGLRGGVELRVWRALIKIR
CVDGCGSNPCPMGSTCIPKEKSSFSCACPNGLTHPLCRRECESQPCLHNATCIVGVNGFE
CNCPLGFSGRSCEMFTGYCAPNPCLHSGKCEERENSYECYCPSGFGGQNCNERVNPCDAL
TCHNGGTCENEKCKCTPGFSGDHCEDRHHNTECEPSFNCGNGICRMINGSAQCFCLPGYS
GTYCSMNVNECLSTPCLNNGSCRDMVNGYYCHCSPGYSGTNCEIDIDECETKPCYNYATC
VDGINLYTCNCVAGFTGTNCEVDIDECESQPCLNEGQCIDHVNVFTCNCTDTGFSGLLCE
NNIDDCLEASCVSNSTCTDLVKDFQCNCFAGYTGKHCEIDIDECAVHPCENEGLCLERSN
DSMYGSNYLGLFPGSFSYENASGYLCHCVPGFRGENCSENINECESNPCINGECIDGINS
FTCSCLRGFEGLNCELEIDECERFQPCFNASACLNTIGDYICDCPDDYGGKNCSVMLTAC
LNNLCENNSTCHQFLIGEHEQAYNCSCLNGFYGRHCQDITTMSLNGSRAVTIAVEKKFDE
HELRFRFRTTLPDGVLFIAQKEDIFYSLMLEKTTLVLTFSSTNTKEYRFGEKLNNAQWNS
VVLRLGSENVSVVLHGHLQSYGEIINLTRPTAWSFSELAMGGAPETALVNPKLFVGCLED
VIINEELLAPSSHVNVVEGCPRKEQCLTDTCSQHGSCTDLWDRFQCDCHRPFFGPSCNYN
YTPGTFGYENTTSLVTVVFPASIEQELKSNIKISMFVRTREETGLIFYLGSSDPVEDDSF
VALDMAFGLPRLFIKNDFEQYTYVLLKKSLNNGDNHLLEIVITRYMQFGIVAGNVLFSIN
NTVALNVTVKLPIEFKNEYLFLGSLPAKLSRMKRQDAYYDFVNSDGTGDKMGTHGYETLT
PFTVGNDNEGVSVNRGGGGATTNGRPFTSLFPDLTPKQSSTVDPHELGILNLTRVRLKAV
LQDVRVNDKMVMFFRNEVEDPMLPIIDSVTVDSVKKGIQSDDVCKVNPCISNATFDGRTS
FISYTSHSIGRINSISFTYRSQRPGLILFARNSSTEFSLILKQKNFQLIQETDGVLVFSF
NLSVVQNLTDGEWHTVKFEFDETKFGLQVDESNAVNKTVENNLSDVLAGEIHIGGNPAST
TNRFSGCLKEARIQNVLLPFFHDTELKNNTSKQRFSVNHINLVSNTECILCFEDLCQHNG
NCSDPYEHFDCSCYGYRGQYCEHDINECEDGIVDCQNGSCNNYPGGFACICILGYEGKFC
DTDLDECEQNPCQNGGSCSNTIGSYKCLCTSNYTGANCEELVLVTCDHSPCQNGGTCHSS
DDDPKYKFNCSCTNGYKGRNCSEERDFCEIGICNDGVCINDPKHATVKCVCNDGFRGERC
EHNINDCEGQQCENGGTCIDGINVYTCLCIDGFKGSNCEEDIDECELKFDMCENGGKCEN
IPGSFNCTCEEPFFGKTCALEDPCLTADNFYCANEGVCRNDEINSTGLLYYCLCSKPYEG
IHCQNKITEAAIDPNSLAIILGPVIGCVLIIIAVAVTVFFMMARKKRATRGTYSPSRQEM
FGSRVELGHVMKPPPEERLI
Download sequence
Identical sequences T1JDK0
SMAR011882-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]