SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SMAR012394-PA from Strigamia maritima 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SMAR012394-PA
Domain Number 1 Region: 5-18,191-406
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.01e-48
Family Nuclear receptor ligand-binding domain 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SMAR012394-PA
Sequence length 443
Comment pep:novel scaffold:Smar1:JH432134:38501:50478:1 gene:SMAR012394 transcript:SMAR012394-RA description:""
Sequence
MGMRADSVQSERKPLDSRERMPSGITGSTQKIYIRKDLRSPLAATPTFVSDKVATDGDVL
EKALGLIDAGLISGNSSSSGNTGRSESADVASPHCYAGLMASLVTSPADLSTLASVVTTL
ATMGKKGELDAGAAELQRMVLNGETAATVVKTEKSLISKAFDTMARAVQSQSPMLHDGQN
RSQEHMPVNICSNENESLFEIDGPLLLDSHIPFHLTTPTPMPAYLNVHYICESASRLLFL
SVHWARSIPAFQLLSPEVQILLVRGCWSELFTLGLSQCSQVMSLTSILSAILNQLQSNVQ
QDKVSVQRVKQVTEHICKLQDYVNMMLRLQVDEHEYAYLKAIVLFSPDHPSLPGSRQVEK
FQDKAHQELPTLRSLLPNIMEDLFFAGLIGNVQIDSVIPYILRMETSDYSNNSSGTSASG
NEAVDMTLNQSNGRSDSSRSSSP
Download sequence
Identical sequences T1JEZ0
SMAR012394-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]