SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SMAR012517-PA from Strigamia maritima 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SMAR012517-PA
Domain Number 1 Region: 100-361
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.21e-63
Family Nuclear receptor ligand-binding domain 0.0000000592
Further Details:      
 
Domain Number 2 Region: 44-127
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 8.05e-30
Family Nuclear receptor 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SMAR012517-PA
Sequence length 454
Comment pep:novel scaffold:Smar1:JH432147:442666:447030:-1 gene:SMAR012517 transcript:SMAR012517-RA description:""
Sequence
MYFSRRHFGLDFDLPRDGELATLHGNASVMPPSSSATTLPGVISQFCAICGDRATGKHYG
AASCDGCKGFFRRSVRKNHMYSCRFERNCLVDKDKRNQCRYCRLKKCFRAGMKKEAVQNE
RDRISCRRPSYDEQIDPNGLSVTTLLTAEMMSRQIGPQNQDTNLTNKKVASVDDVCESMK
QQLLVLVEWAKYIPAFCQLPLDDQVALLRAHAGEHLLLGLSCRSLHLTDILLLGNDYLIP
RHSANVDTSQLGGRIMDELIKPLREVQIDDTEMACLKAIVFFDPAAKGLGNSNKVKALRN
QVQMNLEDYINDRQYESRGRFGEILLTLPTLQSIAWQMIEQIQFAKLFGMAKIDNLLQEM
LLGGTMAPPITYFHLRGGGLNENSSASASNSSTPTTYQPAPPPPPPLPPDLLNGHSDHLN
NGHPDTPIPSPPDSYKLQNIQPFKQEIIDPDGSY
Download sequence
Identical sequences T1JFA6
SMAR012517-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]