SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SMAR012937-PA from Strigamia maritima 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SMAR012937-PA
Domain Number 1 Region: 672-748
Classification Level Classification E-value
Superfamily DEATH domain 0.000000000104
Family DEATH domain, DD 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SMAR012937-PA
Sequence length 755
Comment pep:novel scaffold:Smar1:JH432203:114642:121259:-1 gene:SMAR012937 transcript:SMAR012937-RA description:""
Sequence
MIFHCLAMYRPFHATIYPKAVSQTYDIETKHENIKMTSTIQIIYRWDGSLTTSCLEFAKT
LRYKSANRSLDGAMQMKMATKMATAENSFEAIRKFLSDAVVKSIQDETESLSVIKAKLST
VHTNETETDRKSLIDQSFRDVLSQAIIKDAQKPFYEAIISLAISACHQDLCNATLPVILL
ADLFDCQTINVCEELFEFVEKRVDTWKEDLFFNNTKNNLLRMCNDLLRRLSRSQNTVFCG
RILLFLAKFFPLSERSGLNIVSEFNLDNHTVFMSKDDISMEIGSDNEEMVKVEEKNASEN
SISVDYNLYRKFWTLQDTFCNPTTCYSKFTWKTFTSYASDVLAAFGSFKLDDIKRVTKKF
HLSSDESNKQVYFAKYLTNQKLLDLQLSDHNFRRYVLLQFLILFQYLPAQVKFKGEAHNL
TEDQTAWIEETTQMVYKLLEETPPDGAVFAKTIQHILSREEYWNKWKNDGCPEFQSSKNA
EVDKIVVPQLRKCIQTEILEAAAQGKTLIGNSELTRLWNLCPDNMDACRSEKRDFLPSLE
EFFKEDIESNSDELDEPPTKKKYDGNHAWRALRLLSRRSPDFFTSSNQPIRELGLYLQTM
IKRVAKKKPTTNVEEGKNDTPDKEEVGGAADESEEELLENAEEKKEESQNTQFKEDSENL
QFSPHAVFSADLITSIAREVAPNWKKLATQLSCEEDEVTYFETNNAEPIEQARNMLIVWT
ERDEASPEVLASGLRAVGHSSLAETLEAAEANVAD
Download sequence
Identical sequences T1JGG4
SMAR012937-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]