SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for SMAR013996-PA from Strigamia maritima 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SMAR013996-PA
Domain Number 1 Region: 370-600
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.28e-25
Family RecA protein-like (ATPase-domain) 0.0098
Further Details:      
 
Domain Number 2 Region: 164-308
Classification Level Classification E-value
Superfamily DNA primase core 0.00000889
Family Primase fragment of primase-helicase protein 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SMAR013996-PA
Sequence length 627
Comment pep:novel scaffold:Smar1:JH432114:488887:492150:-1 gene:SMAR013996 transcript:SMAR013996-RA description:""
Sequence
MKDHWKGVTSLKQFPGLTFRSFTNEILTIDVKSVTPTMMKTFLREQNISFTQGHTCLILD
CFLCPHAGKDIVKNGKLYINLVTGMFLCHSCRISGTWTEFQDYIALLKRNHQLNIRHVKR
KPAPDWLINEEENLRTQNILNESIPLANLDQEKYLEIVKKFKIEQITQLTAKKYDLSASK
NGDSIFFPIYGVNGDKVAIRELKSKSDNVKELTIPKRASNMLYGLQKITSSQKKLILTSH
PLDTLIISQEFNLPSLSLPKGLSCLPVETLPLLEQFDSITFWFGGDIKSWEASRTFARKL
GESRCHFIRPKQENLAPLEAMKNNLDLTTILKDVHAVGHKSITSFQALRNEVFTELSQTE
QVAGVKWQRYPILNKLLKGHRRGELTVLTGPTGAGKTTLMSEYSLDLCMQGVSTLWGSFE
IRNVRLAKMMLIQFSQVPLHKKLDLFDKWANEFETLPLYFMTFHGEETIKNVILAMAHAA
YVYDIQHIVVDNLQFMMGTSDTTTTMDRFWKQDAIIAAFRKFASMNNVHVTLVIHPRKEN
SDELHIASIFGGAKASQEADNVLILQDKRLESIKGKKYLQIAKNRFTGDIGIVPLIFNKD
TLSFASKTSKPKEKGKDEKEIECSVCK
Download sequence
Identical sequences T1JJG6
SMAR013996-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]