SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SMAR014583-PA from Strigamia maritima 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SMAR014583-PA
Domain Number 1 Region: 151-429
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.15e-96
Family Protein kinases, catalytic subunit 0.0000000019
Further Details:      
 
Domain Number 2 Region: 9-115
Classification Level Classification E-value
Superfamily PH domain-like 7.08e-23
Family Pleckstrin-homology domain (PH domain) 0.0000169
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SMAR014583-PA
Sequence length 433
Comment pep:novel scaffold:Smar1:JH431868:126320:128775:1 gene:SMAR014583 transcript:SMAR014583-RA description:""
Sequence
MTSPTQYGDAKIIKQGWVLKRGEHIKNWRPRYFILLSDGSLIGFKNKPDHDLSDPLNNFT
VKGCQLMKTDRPKPFTFLIRGLQWTTVIERTFHVESEDEREEWMQAIQYVANTLTDSQDV
EMNDRDSKEDELSQRFSVTSSTTTASHKKKITLENFEFLKMLGKGTFGKVILCREKLTNQ
LYAIKILKKEVIIAKDEVAHTLTENRVLQSTNHPFLTSLKYSFQTADRLCFVMEYVNGGE
LFFHLSKERMFSEERTKFYGAEIISALSYLHEQGIIYRDLKLENLLLDKDGHIKIADFGL
CKEYIAYGDTTKTFCGTPEYLAPEVLDDNDYGRAVDWWGLGVVTYEMMCGRLPFFNNDHD
VLFEMILLTEVKFPRTISPEAKDILSKLLIKDPTKRLGGGPDDAKEIMMHPFFASVDWQE
LIEKKCLLPSSHQ
Download sequence
Identical sequences T1JL53
SMAR014583-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]