SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SMAR014647-PA from Strigamia maritima 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SMAR014647-PA
Domain Number 1 Region: 37-429
Classification Level Classification E-value
Superfamily L domain-like 6.24e-35
Family Ngr ectodomain-like 0.02
Further Details:      
 
Domain Number 2 Region: 699-845
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 6.67e-34
Family Toll/Interleukin receptor TIR domain 0.000095
Further Details:      
 
Domain Number 3 Region: 491-624
Classification Level Classification E-value
Superfamily L domain-like 1.07e-17
Family Ngr ectodomain-like 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SMAR014647-PA
Sequence length 853
Comment pep:novel scaffold:Smar1:JH431975:225649:228210:-1 gene:SMAR014647 transcript:SMAR014647-RA description:""
Sequence
MDLECRCQKNGLIFKQNSTRPFQFQMTFKDDTLNLTGRCDDAFKVQDVLRMWAFPLSTLI
TMTKMMIIVDYFHVHKDKIRSYFDFNSFPRLDSVVNLEFIDKCSKNVRGNISEFFPNLNN
LRILLHRLKKVPENMKMMPRLRKMDLRSNEIEAIDQDDFQGLPELQNLEMSRNEIRILPD
GFLNENSNLELLRLGYNKLTSVPGDLLKNKPKLSKFELHYNQLKTLPENLLDGVTNLYSL
ALKGNKLRSFPPNFFQNVKIESLYLYDNLLTQIPHVKHVKYINLKGNNISHLILPLSDVI
PTAETILLSDNCIRSVTSSNSAIKRNKKMKFECVNCCFDSIPVELAMEVGQLNISDNKIT
KFGLDELKKIYFEDNSVNLVLTNNNITRINTDVYQFIQENPIFDFSSNANMIELRGNPFV
CDCHLNEILKNDLVKRFMNKVFDVEFWRCHDSITGSDVKVDDLNVDGLVCDVLNCPNKCK
CLENRAKQHFRVNCSGAGLNEFPTNFSIPPVHNLLLNLDNNNIKYLPSRTWAMWIAVEEL
DLSRNKLESVKNLTFSDKLTNISLRFNYLTQLEPPILKLFTESNVRTVWLARNHWKCSCD
MRELRNLAVKSKTDFADRQDTRCMVNENDKVSTFDLYDVDDFCTQTRDINTNNAGSIVWP
IVAVIVIIVSVLVILSIRFKLEIKYFLFAKGWCLGLVTEEDIDAAKQYDAFVSYSSADGE
WVRDVLVAGLEEGQPAYKLCLHERDWLAGEFIPEQIVLSVQESRRTIIVLTPDFLSSAWS
QIEFNVAYHKAFEDRVRRLIVVVPKEMPKLDMARDDLRAFLATTTYLEASKPHFWTKLRC
SMPRIRPKDEMIL
Download sequence
Identical sequences T1JLB7
SMAR014647-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]