SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|47459300|ref|YP_016162.1| from Mycoplasma mobile 163K

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|47459300|ref|YP_016162.1|
Domain Number 1 Region: 539-852
Classification Level Classification E-value
Superfamily Ribokinase-like 1.43e-59
Family Ribokinase-like 0.00022
Further Details:      
 
Domain Number 2 Region: 46-145,189-397
Classification Level Classification E-value
Superfamily Arabinanase/levansucrase/invertase 6.07e-58
Family Glycosyl hydrolases family 32 N-terminal domain 0.00014
Further Details:      
 
Domain Number 3 Region: 395-529
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.32e-16
Family Glycosyl hydrolases family 32 C-terminal domain 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|47459300|ref|YP_016162.1|
Sequence length 853
Comment sucrose-6-phosphate hydrolase [Mycoplasma mobile 163K]
Sequence
MKNFKNILVELKNKLNREQFNYLNEKNNFQEKIKENFKAKSKDLHFRNNFSLEPKSGLLN
DPNGLVFFNDFYYIFFQNSPHINKHDLKVWSLYKTKDFLNYTYEGQKISPSIEKDADGIY
SGGSIVENDELYLFYTGIEKKYFRKINIEKIKNFFSLADFILESNMHKTLKEIYLESLIS
KIIKFIENLEESNIFLAKRNTSENFDKTFLFKRDRNLYTRHFRDPLALKKDNNFYLLIGA
QLKETLKGVISVYKSKKVDKDYRLIGNIKFKNFSIESYMLECPEFLRINNKDIIIFSTQG
KSYFNFRKNNESIHNAIYLVGKMNWNTLEFDVEFQDFLDYGFDFYAPQVFKNVDENILIG
WNGRPDISFHDENLGWSFNLSIPRKLYLKNNELIQEPIFQLENEVLNVESNKISKKQNGL
YEIRFEKEKNFSEISIFNEKHNISIKLDWDNLFINVNRTNMEVNYGENIGTNWVRKMPKK
YSKMNLIVDNSLIHFYFDEGKFHFTFYYFIKKSNIKFKNFSNITFRQIKSLKIKDKSKKV
LLIGEALIDTYKQNFEISRQVGGAPLNVSLALSKKGVQNSFFGVIGKDEDASLILEYFKR
NNLDTSLLKIDPKLKTTVANVSINDEGERNFTFVRGADENLNFEYDALINQYDLVCFSSA
TAFLGGKLYKSYIKALNLSLDANIDVVFDPNYRDSLYSKNIEDFKQKAKYFITKSNVVKM
SLEELEIIYKLKWNSKNDTETLHKEMKKIIENDQQFFLITLGKDGTLFIDKNKIKIIPSI
KVKQVDTTGAGDVFLGSFISKYINRNNKDSNSKDFHNEIFEIIKYANVNGALATTIIGVE
NALKTEEEINELI
Download sequence
Identical sequences Q6KHH9
267748.MMOB4650 WP_011264985.1.31918 gi|47459300|ref|YP_016162.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]