SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000001036 from Mus musculus 69_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000001036
Domain Number 1 Region: 910-1193
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.24e-71
Family Protein kinases, catalytic subunit 0.00000622
Further Details:      
 
Domain Number 2 Region: 598-892
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.81e-46
Family Protein kinases, catalytic subunit 0.0000985
Further Details:      
 
Domain Number 3 Region: 470-576,605-631
Classification Level Classification E-value
Superfamily SH2 domain 0.000000000199
Family SH2 domain 0.0059
Further Details:      
 
Domain Number 4 Region: 394-459
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000701
Family Third domain of FERM 0.031
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000001036
Domain Number - Region: 204-292
Classification Level Classification E-value
Superfamily Second domain of FERM 0.022
Family Second domain of FERM 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000001036   Gene: ENSMUSG00000032175   Transcript: ENSMUST00000001036
Sequence length 1207
Comment pep:known chromosome:GRCm38:9:21104069:21127346:-1 gene:ENSMUSG00000032175 transcript:ENSMUST00000001036 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVGTMPLCGRRAILEDSKADGTEAQPLVPTGCLMVLLHWPGPEGGEPWVTFSQTSLTAEE
VCIHIAHKVGITPPCLNLFALYNAQAKVWLPPNHILDTSQDMNLYFRMRFYFRNWHGMNP
QEPAVYRCGFPGAETSSDRAEQGVQLLDSASFEYLFEQGWYVGNRAKSSHTSFSIHRSTP
QGKHEFMNDVVSLRDLSSEEEIHHFKNESLGMAFLHLCHLALSRGVPLEEMAREISFKNC
IPHSFRQHIRQHNVLTRLRLHRVFRRFLRAFRPGHLSQQVVMVKYLATLERLAPRFGSER
IPVCHLEVLAQPERDPCYIQNSGQTAGDPGPELPSGPPTHEVLVTGTGGIQWHPLQTQES
ERGNSRGNPHGSRSGKKPKAPKAGEHLTESPQEPPWTYFCDFQDISHVVLKERRVHIHLQ
DNKCLLLCLCSQAEALSFVALVDGYFRLTADSSHYLCHEVAPPRLVTSIQNGIHGPLMDP
FVQAKLWPEDGLYLIQWSTSHLHRLILTVAHRNPAFSNGPRGLRLRKFPITQQPGAFVLD
GWGRSFASLGDLRLALQGCSLRAGDDCFPLHHCCLPRPREISNLVIMRGSRAHTRPLNLS
QLSFHRVHQDEITQLSHLGQGTRTNVYEGLLRVGGPDEGKVDNGCPPEPGGTSGQQLRVV
LKVLDPSHHDIALAFYETASLMSQVSHMHLAFLHGVCVRGSENIIVTEFVEHGPLDVWLR
RQRGQVPMTWKMVVAQQLASALSYLEDKNLVHGNVCGRNILLARLGLEEGTNPFIKLSDP
GVGQGALSREERVERIPWTAPECLSGGTSSLGTATDMWGFGATLLEICFDGEAPLQGRGP
SEKERFYTKKHQLPEPSSPELATLTRQCLTYEPAQRPSFRTILRDLTRLQPQNLVGTSAV
NSDSPASDPTVFHKRYLKKIRDLGEGHFGKVSLYCYDPTNDGTGEMVAVKALKEGCGPQL
RSGWQREIEILRTLYHEHIVKYKGCCEDQGEKSVQLVMEYVPLGSLRDYLPRHCVGLAQL
LLFAQQICEGMAYLHAQHYIHRDLAARNVLLDNDRLVKIGDFGLAKAVPEGHEYYRVRED
GDSPVFWYAPECLKECKFYYASDVWSFGVTLYELLTYCDSNQSPHMKFTELIGHTQGQMT
VLRLTELLERGERLPRPDRCPCEIYHLMKNCWETEASFRPTFQNLVPILQTAQEKYQGQV
PSVFSVC
Download sequence
Identical sequences E9QJS1
ENSMUSP00000001036 ENSMUSP00000001036 NP_001192241.1.92730 10090.ENSMUSP00000001036 ENSMUSP00000001036

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]