SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000002121 from Mus musculus 69_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000002121
Domain Number 1 Region: 348-467,517-756
Classification Level Classification E-value
Superfamily Tex N-terminal region-like 3.79e-59
Family Tex N-terminal region-like 0.0083
Further Details:      
 
Domain Number 2 Region: 777-931
Classification Level Classification E-value
Superfamily Ribonuclease H-like 4.93e-24
Family Tex RuvX-like domain-like 0.0085
Further Details:      
 
Domain Number 3 Region: 946-1038
Classification Level Classification E-value
Superfamily RuvA domain 2-like 0.00000000000289
Family Tex HhH-containing domain-like 0.0065
Further Details:      
 
Domain Number 4 Region: 1326-1417
Classification Level Classification E-value
Superfamily SH2 domain 0.000000000106
Family SH2 domain 0.0036
Further Details:      
 
Domain Number 5 Region: 1227-1284
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.0000000936
Family Cold shock DNA-binding domain-like 0.0099
Further Details:      
 
Domain Number 6 Region: 1051-1139
Classification Level Classification E-value
Superfamily RuvA domain 2-like 0.00000667
Family Tex HhH-containing domain-like 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000002121   Gene: ENSMUSG00000002052   Transcript: ENSMUST00000002121
Sequence length 1726
Comment pep:known chromosome:GRCm38:11:78206746:78245987:-1 gene:ENSMUSG00000002052 transcript:ENSMUST00000002121 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDFVESEAEESEEEYNHEGEVVPRVTKKFVEEEDDDEEEEEENLDDQDERGNLKDFIND
DDDEEEGEEDEGSDSGDSEDDVGHKKRKRPSFDDRLEDDDFDLIEENLGVKVKRGQKYRR
VKKMSDDDEDDEEEYGKEEHEKEAIAGEIFQDEEGEEGQEAVEAPMAPPDEEEEDDEESD
IDDFIVDDDGQPLKKPKWRKKLPGYTDAALQEAQEIFGVDFDYDEFEKYNEYDEELEEDY
EYEDDETEGEIRVRPKKTTKKRVSRRSIFEMYEPSELESSHLTDQDNEIRATDLPERFQL
RSIPVKAAEDDELEEEADWIYRNAFATPTISLQDSCDYLDRGQPTSSFSRKGPSTVQKIK
EALGFMRNQHFEVPFIAFYRKEYVEPELHINDLWRVWQWDEKWTQLRIRKENLTRLFEKM
QAYQYEQISADPDKPLADGIRALDTTDMERLKDVQSMDELKDVYNHFLLYYGRDIPKMQN
AAKASRKKLKRIKEDGDEEGEGEEAEDEEQRGPELKQASRRDMYTICQSAGLDGLAKKFG
LTPEQFGENLRDSYQRHETEQFPAEPLELAKDYVCSQFPTPEAVLEGARYMVALQIAREP
LVRQVLRQTFQERAKLNITPTKKGRKDVDEAHYAYSFKYLKNKPVKELRDDQFLKIGLAE
DEGLLTIDISIDMKGVEGYGNDQTYFEEIKQFYYRDEFSHQVQEWNRQRTMAIERALQQF
LYVQMAKELKNKLLAEARESVVKACSRKLYNWLRVAPYRPDQQVEEDDDFMDENQGKGIR
VLGIAFSSARDHPVFCALVNGEGEVTDFLRLPHFTKRRTAWREEEREKKAQDIETLKKFL
VNKKPHVVTIAGENRDAQMLTEDVKRIVHELDQGQQLSSIGVELVDNELAILYMNSKKSE
AEFRDYPPVLRQAVSLARRIQDPLIEFAQVCSSDEDILCLKFHPLQEHVVKEELLNALYC
EFINRVNEVGVDVNRAIAHPYSQALIQYVCGLGPRKGTHLLKILKQNNTRLESRTQLVTM
CHMGPKVFMNCAGFLKIDTASLGDSTDSYIEVLDGSRVHPETYEWARKMAVDALEYDESA
EDANPAGALEEILENPERLKDLDLDAFAEELERQGYGDKHITLYDIRAELSCRYKDLRTA
YRSPNTEEIFNMLTKETPETFYIGKLIICNVTGIAHRRPQGESYDQAIRNDETGLWQCPF
CQQDNFPELSEVWNHFDSGSCPGQAIGVKTRLDNGVTGFIPTKFLSDKVVKRPEERVKVG
MTVHCRIMKIDIEKFSADLTCRTSDLMDRNNEWKLPKDTYYDFDAEAADHKQEEDMKRKQ
QRTTYIKRVIAHPSFHNINFKQAEKMMETMDQGDVIIRPSSKGENHLTVTWKVSAGIYQH
VDVREEGKENAFSLGATLWINSEEFEDLDEIVARYVQPMASFARDLLNHKYYQDCSGGDR
KKLEELLIKTKKEKPTFIPYFICACKELPGKFLLGYQPRGKPRIEYVTVTPEGFRYRGQI
FPTVNGLFRWFKDHYQDPVPGITPSSSNRTRTPASINATPANINLADLTRAVNALPQNMT
SQMFSAIAAVTGQGQNPNATPAQWASSQYGYGGSGGGSSAYHVFPTPAQQPVATPLMTPS
YSYTTPSQPITTPQYHQLQASTTPQSTQAQPQPSSSSRQRQQQPKSNSHAAIDWGKMAEQ
WLQEKEAERRKQKQRLTPRPSPSPMIESTPMSIAGDATPLLDEMDR
Download sequence
Identical sequences Q62383
10090.ENSMUSP00000002121 ENSMUSP00000002121 ENSMUSP00000002121 NP_033323.2.92730 ENSMUSP00000002121

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]