SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000002379 from Mus musculus 69_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000002379
Domain Number 1 Region: 46-83
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000017
Family LDL receptor-like module 0.00055
Further Details:      
 
Domain Number 2 Region: 123-159
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000589
Family LDL receptor-like module 0.00077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000002379   Gene: ENSMUSG00000002308   Transcript: ENSMUST00000002379
Sequence length 260
Comment pep:known chromosome:GRCm38:17:33843091:33849774:1 gene:ENSMUSG00000002308 transcript:ENSMUST00000002379 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARGGAGRAVALGLVLRLLFGLRTGLEAAPAPAHTRVQVSGSRADSCPTDTFQCLTSGYC
VPLSWRCDGDQDCSDGSDEEDCRIESCAQNGQCQPQSALPCSCDNISGCSDVSDKNLNCS
RPPCQESELHCILDDVCIPHTWRCDGHPDCLDSSDELSCDTDTEIDKIFQEENATTTRIS
TTMENETSFRNVTFTSAGDSSRNPSAYGVIAAAGVLSAILVSATLLILLRLRGQGYLPPP
GLLVAVKESLLLSERKTSLI
Download sequence
Identical sequences Q9Z1P5
ENSMUSP00000002379 10090.ENSMUSP00000002379 ENSMUSP00000002379 NP_062294.3.92730 ENSMUSP00000002379

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]