SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000006838 from Mus musculus 69_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000006838
Domain Number 1 Region: 263-571
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 3.75e-88
Family Class I aminoacyl-tRNA synthetases (RS), catalytic domain 0.000000101
Further Details:      
 
Domain Number 2 Region: 565-771
Classification Level Classification E-value
Superfamily Ribosomal protein L25-like 1.41e-55
Family Gln-tRNA synthetase (GlnRS), C-terminal (anticodon-binding) domain 0.0000171
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000006838   Gene: ENSMUSG00000032604   Transcript: ENSMUST00000006838
Sequence length 775
Comment pep:known chromosome:GRCm38:9:108508005:108515941:1 gene:ENSMUSG00000032604 transcript:ENSMUST00000006838 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATPDSLALFTGLGLSENKARETLKNEALSTQLREAATQAHQILGSTIDKATGVLLYDLV
SRLRDTRRRSFLVSYIANKKIHTGLQLSAALEYVRSHPQDPIDTKDFEQECGVGVVVTPE
QIEEAVESTINKHQLQLLAERYRFNMGLLMGEARAALRWADGKMIKNEVDMQVLHLLGPK
MEADLVKKPKVAKARLEETDRKTAKDVVEKGEVAGQTLSLMEQLRGEALKFHKPGENYKT
PGYVITPYTMDLLKQHLEITGGQVRTRFPPEPNGILHIGHAKAINFNFGYAKANNGICFL
RFDDTNPEKEEAKFFTAIYDMVTWLGYTPYKVTYASDYFDQLYAWAVELIHGGLAYVCHQ
RVEELKGHNPLPSPWRDRPKEESLLLFEAMRKGKFAEGEATLRMKLVMEDGKMDPVAYRV
KYTPHHRTGDKWCIYPTYDYTHCLCDSIEHITHSLCTKEFQARRSSYFWLCNALKVYCPV
QWEYGRLNLHYAVVSKRKILQLVAAGAVRDWDDPRLFTLTALRRRGFPPEAINNFCARVG
VTVAQTTMEPHLLEACVRDVLNDAAPRAMAVLEPLQVVITNFPAPKPLDIRVPNFPADET
KGFHQVPFASTVFIERSDFKEESEPGYKRLASGQPVGLRHTGYVIELQNIVRGSSGCVER
LEVTCRRADAGEKPKAFIHWVSQPLVCEIRLYECLFQHKNPEDPVEVPGGFLSDLNPASL
QVVEGALVDCSVALAKPFDKFQFERLGYFSVDPDSHQGQIVFNRTVTLKEDPGKI
Download sequence
Identical sequences Q8BML9
ENSMUSP00000006838 NP_598555.2.92730 10090.ENSMUSP00000006838 ENSMUSP00000006838 ENSMUSP00000006838

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]