SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000016498 from Mus musculus 69_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000016498
Domain Number 1 Region: 233-498
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.69e-77
Family Protein kinases, catalytic subunit 0.000000188
Further Details:      
 
Domain Number 2 Region: 131-264
Classification Level Classification E-value
Superfamily SH2 domain 4.58e-35
Family SH2 domain 0.00035
Further Details:      
 
Domain Number 3 Region: 70-153
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000105
Family SH3-domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000016498   Gene: ENSMUSG00000027579   Transcript: ENSMUST00000016498
Sequence length 507
Comment pep:known chromosome:GRCm38:2:181205562:181213185:-1 gene:ENSMUSG00000027579 transcript:ENSMUST00000016498 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRFRPQPGPLGMEPFLRKRLTFLSFFWDKIWPADESEEDIPRIQGHDDNPVPEQAAAVEP
CSFPAPRARLFRALYDFTARCAEELSVSRGDRLYALKEEGDYIFAQRLSGPPSTGLVPVT
YLAKATPEPPSDQPWYFSGISRAQAQQLLLSPANAPGAFLIRPSESSIGGYSLSVRAQAK
VCHYRICMAPSGSLYLQEGQLFPSLDALLAYYKTNWKLIQNPLLQPCIPQIPLVQDEWER
PRSEFVLRRKLGEGFFGEVWEGLWLGSIPVAVKVIKSADMKLADLTKEIEALKSLRHERL
IRLHAICSLGEPVYIVTELMGKGNLQVYLGSSEGKALSLPHLLGFACQVAEGMSYLEERR
VVHRDLAARNVLVGDDLTCKVADFGLARLLKDDVYSPSSGSKIPVKWTAPEAANYRVFSQ
KSDVWSFGILLYEVFTYGQCPYEGMTNHETLQQISRGYRLPRPAVCPAEVYVLMVECWKG
SPEERPTFAILREKLNAINRRLHLGLT
Download sequence
Identical sequences Q0VBH4
ENSMUSP00000016498 ENSMUSP00000016498 ENSMUSP00000016498 10090.ENSMUSP00000016498 NP_035611.3.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]