SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000016511 from Mus musculus 69_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000016511
Domain Number 1 Region: 166-440
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.48e-82
Family Protein kinases, catalytic subunit 0.000000253
Further Details:      
 
Domain Number 2 Region: 74-211
Classification Level Classification E-value
Superfamily SH2 domain 1.18e-33
Family SH2 domain 0.00000742
Further Details:      
 
Domain Number 3 Region: 11-94
Classification Level Classification E-value
Superfamily SH3-domain 5.34e-18
Family SH3-domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000016511   Gene: ENSMUSG00000038751   Transcript: ENSMUST00000016511
Sequence length 451
Comment pep:known chromosome:GRCm38:2:181193721:181202789:-1 gene:ENSMUSG00000038751 transcript:ENSMUST00000016511 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVSWDKAHLGPKYVGLWDFKARTDEELSFQAGDLLHVTKKEELWWWATLLDAEGKALAEG
YVPHNYLAEKETVESEPWFFGCISRSEAMHRLQAEDNSKGAFLIRVSQKPGADYVLSVRD
AQAVRHYRIWKNNEGRLHLNEAVSFSNLSELVDYHKTQSLSHGLQLSMPCWKHKTEPLPH
WDDWERPREEFTLCKKLGAGYFGEVFEALWKGQVHVAVKVISRDNLLHQHTFQAEIQAMK
KLRHKHILSLYAVATAGDPVYIITELMPKGNLLQLLRDSDEKALPILELVDFASQVAEGM
CYLESQNYIHRDLAARNVLVTENNLCKVGDFGLARLVKEDIYLSHEHNVPYKWTAPEALS
RGHYSIKSDVWSFGVLLHEIFSRGQMPYPGMSNHETFLRVDAGYRMPCPLECPPNIHKLM
LSCWSRDPKQRPCFKDLCEKLTGITRYENLV
Download sequence
Identical sequences Q05AA8 Q64434
ENSMUSP00000016511 10090.ENSMUSP00000016511 ENSMUSP00000016511 ENSMUSP00000016511 NP_033210.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]