SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000019965 from Mus musculus 69_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000019965
Domain Number 1 Region: 7-279
Classification Level Classification E-value
Superfamily DNase I-like 5.89e-57
Family Sphingomyelin phosphodiesterase-like 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000019965   Gene: ENSMUSG00000019822   Transcript: ENSMUST00000019965
Sequence length 419
Comment pep:known chromosome:GRCm38:10:41487172:41490340:-1 gene:ENSMUSG00000019822 transcript:ENSMUST00000019965 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLNFSLRLRVFNLNCWDIPYLSKHRADRMKRLGDFLNLENFDLALLEEVWSEQDFQYLR
QRLSLTYPDAHYFRSGMIGSGLCVFSKHPIQEIFQHVYSLNGYPYMFHHGDWFCGKSVGL
LVLRLSGLVLNAYVTHLHAEYSRQKDIYFAHRVAQAWELAQFIHHTSKNADVVLLCGDLN
MHPKDLGCCLLKEWTGLHDAFVETEDFKGSDDGCTMVPKNCYVSQQDLGPFPSGIRIDYV
LYKAVSEFHVCCETLKTTTGCDPHSDKPFSDHEALMATLYVKHSPPQEDPCTACGPLERS
DLISVLREARTELGLGIAKARWWAAFSGYVIVWGLSLLVLLCVLAAGEEAREVAIILCIP
SVGLVLVAGAVYLFHKQEAKGLCRAQAEMLHVLTRETETQDRGSEPHLAYCLQQEGDRA
Download sequence
Identical sequences O70572
ENSMUSP00000019965 NP_033239.1.92730 ENSMUSP00000019965 10090.ENSMUSP00000019965 ENSMUSP00000019965

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]