SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000020575 from Mus musculus 69_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000020575
Domain Number 1 Region: 100-165
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000000735
Family Ovomucoid domain III-like 0.0017
Further Details:      
 
Domain Number 2 Region: 196-241
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000416
Family Ovomucoid domain III-like 0.0081
Further Details:      
 
Domain Number 3 Region: 33-71
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.00000458
Family TB module/8-cys domain 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000020575   Gene: ENSMUSG00000020325   Transcript: ENSMUST00000020575
Sequence length 256
Comment pep:known chromosome:GRCm38:10:79777272:79782630:1 gene:ENSMUSG00000020325 transcript:ENSMUST00000020575 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRSGALWPLLWGALVWTVGSVGAVMGSEDSVPGGVCWLQQGREATCSLVLKTRVSREECC
ASGNINTAWSNFTHPGNKISLLGFLGLVHCLPCKDSCDGVECGPGKACRMLGGRPHCECV
PNCEGLPAGFQVCGSDGATYRDECELRTARCRGHPDLRVMYRGRCQKSCAQVVCPRPQSC
LVDQTGSAHCVVCRAAPCPVPSNPGQELCGNNNVTYISSCHLRQATCFLGRSIGVRHPGI
CTGGPKVPAEEEENFV
Download sequence
Identical sequences Q542M9 Q9EQC7
10090.ENSMUSP00000020575 ENSMUSP00000020575 ENSMUSP00000020575 ENSMUSP00000020575 NP_113557.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]