SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000020959 from Mus musculus 69_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000020959
Domain Number 1 Region: 138-282
Classification Level Classification E-value
Superfamily Ribonuclease H-like 3.41e-45
Family Ribonuclease H 0.00044
Further Details:      
 
Domain Number 2 Region: 27-71
Classification Level Classification E-value
Superfamily L9 N-domain-like 0.000000000000046
Family N-terminal domain of RNase HI 0.0009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000020959   Gene: ENSMUSG00000020630   Transcript: ENSMUST00000020959
Sequence length 285
Comment pep:known chromosome:GRCm38:12:28649602:28659591:1 gene:ENSMUSG00000020630 transcript:ENSMUST00000020959 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRWLLPLSRTVTLAVVRLRRGICGLGMFYAVRRGRRTGVFLSWSECKAQVDRFPAARFKK
FATEDEAWAFVRSSSSPDGSKGQESAHEQKSQAKTSKRPREPLGEGEELPEPGPKHTRQD
TEPSAVVSKDAFSYMGESVVVYTDGCCSSNGRKRARAGIGVYWGPGHPLNVGIRLPGRQT
NQRAEIHAACKAIMQAKAQNISKLVLYTDSMFTINGITNWVQGWKKNGWRTSTGKDVINK
EDFMELDELTQGMDIQWMHIPGHSGFVGNEEADRLAREGAKQSED
Download sequence
Identical sequences E9QLN8
NP_035405.2.92730 10090.ENSMUSP00000020959 ENSMUSP00000020959 ENSMUSP00000020959 ENSMUSP00000020959

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]