SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000021564 from Mus musculus 69_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000021564
Domain Number 1 Region: 323-441
Classification Level Classification E-value
Superfamily EF-hand 3.53e-31
Family Osteonectin 0.0093
Further Details:      
 
Domain Number 2 Region: 234-304
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 2.22e-20
Family Thyroglobulin type-1 domain 0.0016
Further Details:      
 
Domain Number 3 Region: 89-160
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 3.92e-19
Family Thyroglobulin type-1 domain 0.0014
Further Details:      
 
Domain Number 4 Region: 41-87
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000915
Family Ovomucoid domain III-like 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000021564   Gene: ENSMUSG00000021136   Transcript: ENSMUST00000021564
Sequence length 463
Comment pep:known chromosome:GRCm38:12:81026828:81186410:1 gene:ENSMUSG00000021136 transcript:ENSMUST00000021564 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPARVRLLTPHLLLVLVQLSPAGGHRTTGPRFLISDRDPPCNPHCPRTQPKPICASDGR
SYESMCEYQRAKCRDPALAVVHRGRCKDAGQSKCRLERAQALEQAKKPQEAVFVPECGED
GSFTQVQCHTYTGYCWCVTPDGKPISGSSVQNKTPVCSGPVTDKPLSQGNSGRKVSFRFF
LTLNSDDGSKPTPTMETQPVFDGDEITAPTLWIKHLVIKDSKLNNTNVRNSEKVHSCDQE
RQSALEEARQNPREGIVIPECAPGGLYKPVQCHQSTGYCWCVLVDTGRPLPGTSTRYVMP
SCESDARAKSIEADDPFKDRELPGCPEGKKMEFITSLLDALTTDMVQAINSAAPTGGGRF
SEPDPSHTLEERVAHWYFSQLDSNSSDDINKREMKPFKRYVKKKAKPKKCARRFTDYCDL
NKDKVISLPELKGCLGVSKEGGSLGSFPQGKRAGTNPFIGRLV
Download sequence
Identical sequences A0A0R4J1E4
ENSMUSP00000021564 NP_001139689.1.92730 ENSMUSP00000105976 ENSMUSP00000105976 10090.ENSMUSP00000105976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]