SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000022230 from Mus musculus 69_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMUSP00000022230
Domain Number - Region: 13-35
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000523
Family Retrovirus zinc finger-like domains 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000022230   Gene: ENSMUSG00000021716   Transcript: ENSMUST00000022230
Sequence length 153
Comment pep:known chromosome:GRCm38:13:104817177:104839274:1 gene:ENSMUSG00000021716 transcript:ENSMUST00000022230 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVPGCNKDNVRAGCRKCGYPGHLTFECRNFLRVDPKRDIVLDVSSTSSEDSDEENEELN
KLQALQEKRINEEEEKKKEKSREKIKLKKRRKRSYSSATEEDSAKQKKQKYQKKEKKKEK
KNKSKKGKHHKKEKKKRKKEKRSSPYHSELTKK
Download sequence
Identical sequences Q4V9W2
ENSMUSP00000022230 ENSMUSP00000022230 NP_080351.2.92730 10090.ENSMUSP00000022230 ENSMUSP00000022230

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]