SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000022287 from Mus musculus 69_38

(show help)
Strong hits

Sequence:	ENSMUSP00000022287
Domain Number 1	Region: 98-164
Classification Level	Classification	E-value
Superfamily	Kazal-type serine protease inhibitors	0.0000000000000412
Family	Ovomucoid domain III-like	0.00017
Further Details:

Domain Number 2	Region: 261-315
Classification Level	Classification	E-value
Superfamily	Kazal-type serine protease inhibitors	0.0000000000018
Family	Ovomucoid domain III-like	0.0076
Further Details:

Domain Number 3	Region: 191-239
Classification Level	Classification	E-value
Superfamily	Kazal-type serine protease inhibitors	0.00000000000818
Family	Ovomucoid domain III-like	0.0086
Further Details:

Domain Number 4	Region: 27-65
Classification Level	Classification	E-value
Superfamily	TB module/8-cys domain	0.0000569
Family	TB module/8-cys domain	0.0081
Further Details:

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by

Biological Process	IC (bits)	H-Score

Cellular Component	IC (bits)	H-Score

Molecular Function	IC (bits)	H-Score

External link(s)	Protein: ENSMUSP00000022287 Gene: ENSMUSG00000021765 Transcript: ENSMUST00000022287
Sequence length	343
Comment	pep:known chromosome:GRCm38:13:114452262:114458730:-1 gene:ENSMUSG00000021765 transcript:ENSMUST00000022287 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence	MVCARHQPGGLCLLLLLLCQFMEDRSAQAGNCWLRQAKNGRCQVLYKTELSKEECCSTGR LSTSWTEEDVNDNTLFKWMIFNGGAPNCIPCKETCENVDCGPGKKCRMNKKNKPRCVCAP DCSNITWKGPVCGLDGKTYRNECALLKARCKEQPELEVQYQGKCKKTCRDVFCPGSSTCV VDQTNNAYCVTCNRICPEPSSSEQYLCGNDGVTYSSACHLRKATCLLGRSIGLAYEGKCI TKSCEDIQCGGGKKCLWDSKVGRGRCSLCDELCPDSKSDEPVCASDNATYASECAMKEAA CSSGVLLEVKHSGSCNSISEETEEEEEEEDQDYSFPISSILEW
Download sequence
Identical sequences	A0A0R4J026 ENSMUSP00000022287 10090.ENSMUSP00000022287 NP_032072.1.92730 ENSMUSP00000022287 ENSMUSP00000022287

SEARCH