SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000026234 from Mus musculus 69_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000026234
Domain Number 1 Region: 179-277
Classification Level Classification E-value
Superfamily Immunoglobulin 2.53e-21
Family I set domains 0.018
Further Details:      
 
Domain Number 2 Region: 59-146
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000235
Family Growth factor receptor domain 0.0021
Further Details:      
 
Domain Number 3 Region: 131-178
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000707
Family Ovomucoid domain III-like 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000026234   Gene: ENSMUSG00000025213   Transcript: ENSMUST00000026234
Sequence length 313
Comment pep:known chromosome:GRCm38:19:45076139:45079289:1 gene:ENSMUSG00000025213 transcript:ENSMUST00000026234 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRVFTGLPANYAAPTLALSLLLPLLLVVWTQLPVSARPSTGPDYLRRGWLRLLAEGEGC
APCRPEECAAPRGCLAGRVRDACGCCWECANLEGQLCDLDPSANFYGRCGEQLECRLDAG
GDLSRGEVPEPLCVCRSQRPLCGSDGRTYAQICRLQEAARARLDANLTVVHPGPCESEPQ
ILSQPHNIWNVTGQDVIFGCEVFAYPMASIEWRKDGLDIQLPGDDPHISVQFRGGPQKFE
VTGWLQIQALRPSDEGTYRCLARNALGQAEASATLTVLTPEQLNATGFSQLQSRSLFPEE
EEEAESEELGDYY
Download sequence
Identical sequences Q8BJ66
NP_849260.2.92730 XP_006526629.1.92730 XP_006526630.1.92730 XP_006526631.1.92730 XP_017173531.1.92730 ENSMUSP00000026234 NYSGRC-IgSF-Q8BJ66 ENSMUSP00000026234 ENSMUSP00000107579 ENSMUSP00000026234 10090.ENSMUSP00000107579

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]