SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000027826 from Mus musculus 69_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000027826
Domain Number 1 Region: 5-148
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.05e-34
Family Dual specificity phosphatase-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000027826   Gene: ENSMUSG00000026544   Transcript: ENSMUST00000027826
Sequence length 150
Comment pep:known chromosome:GRCm38:1:172630769:172632974:-1 gene:ENSMUSG00000026544 transcript:ENSMUST00000027826 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGVQPPNFSWVLPGRLAGLALPRLPAHYQFLLDQGVRHLVSLTERGPPHSDSCPGLTLHR
MRIPDFCPPSPEQIDQFVKIVDEANARGEAVGVHCALGFGRTGTMLACYLVKERALAAGD
AIAEIRRLRPGSIETYEQEKAVFQFYQRTK
Download sequence
Identical sequences Q6NT99
ENSMUSP00000027826 10090.ENSMUSP00000027826 NP_081001.1.92730 XP_021054795.1.100879 ENSMUSP00000027826 ENSMUSP00000027826

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]