SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000028846 from Mus musculus 69_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000028846
Domain Number 1 Region: 166-314
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.63e-44
Family Dual specificity phosphatase-like 0.000000371
Further Details:      
 
Domain Number 2 Region: 7-151
Classification Level Classification E-value
Superfamily Rhodanese/Cell cycle control phosphatase 1.57e-20
Family Cell cycle control phosphatase, catalytic domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000028846   Gene: ENSMUSG00000027368   Transcript: ENSMUST00000028846
Sequence length 318
Comment pep:known chromosome:GRCm38:2:127336159:127338376:1 gene:ENSMUSG00000027368 transcript:ENSMUST00000028846 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPIAMGLETACELECAALGALLREPREAERTLLLDCRPFLAFCRSHVRAARPVPWNALLR
RRARGTPAAALACLLPDRALRARLGRGELARAVVLDESSASVAELPPDGPAHLLLAALQH
EMRGGPTTVCFLRGGFKSFQTYCPDLCSEAPAQALPPAGAENSNSDPRVPIYDQGGPVEI
LPYLYLGSCNHSSDLQGLQACGITAVLNVSASCPNHFEGLFHYKSIPVEDNQMVEISAWF
QEAISFIDSVKNSGGRVLVHCQAGISRSATICLAYLIQSHRVRLDEAFDFVKQRRGVISP
NFSFMGQLLQLETQVLCH
Download sequence
Identical sequences Q05922
ENSMUSP00000028846 NP_034220.2.92730 ENSMUSP00000028846 ENSMUSP00000028846 10090.ENSMUSP00000028846

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]