SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000028921 from Mus musculus 69_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMUSP00000028921
Domain Number - Region: 252-282
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00131
Family Retrovirus zinc finger-like domains 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000028921   Gene: ENSMUSG00000027433   Transcript: ENSMUST00000028921
Sequence length 951
Comment pep:known chromosome:GRCm38:2:147012996:147078000:1 gene:ENSMUSG00000027433 transcript:ENSMUST00000028921 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGVPAFFRWLSRKYPSIIVNCVEEKPKECNGVKIPVDASKPNPNDVEFDNLYLDMNGIIH
PCTHPEDKPAPKNEDEMMVAIFEYIDRLFNIVRPRRLLYMAIDGVAPRAKMNQQRSRRFR
ASKEGMEAAVEKQRVREEILAKGGFLPPEEIKERFDSNCITPGTEFMDNLAKCLRYYIAD
RLNNDPGWKNLTVILSDASAPGEGEHKIMDYIRRQRAQPNHDPNTHHCLCGADADLIMLG
LATHEPNFTIIREEFKPNKPKPCALCNQFGHEVKDCEGLPREKKGKHDELADSLPCAEGE
FIFLRLNVLREYLERELTMASLPFPFDVERSIDDWVFMCFFVGNDFLPHLPSLEIREGAI
DRLVNIYKNVVHKTGGYLTESGYVNLQRVQMIMLAVGEVEDSIFKKRKDDEDSFRRRQKE
KRKRMKRDQPAFTPSGILTPHALGSRNSPGCQVASNPRQAAYEMRMQRNSSPSISPNTSF
ASDGSPSPLGGIKRKAEDSDSEPEPEDNVRLWEAGWKQRYYKNKFDVDAADEKFRRKVVQ
SYVEGLCWVLRYYYQGCASWKWYYPFHYAPFASDFEGIADMSSEFEKGTKPFKPLEQLMG
VFPAASGNFLPPTWRKLMSDPDSSIIDFYPEDFAIDLNGKKYAWQGVALLPFVDERRLRA
ALEEVYPDLTPEENRRNSLGGDVLFVGKLHPLRDFILELYQTGSTEPVDVPPELCHGIQG
TFSLDEEAILPDQTVCSPVPMLRDLTQNTAVSINFKDPQFAEDYVFKAAMLPGARKPATV
LKPGDWEKSSNGRQWKPQLGFNRDRRPVHLDQAAFRTLGHVTPRGSGTSVYTNTALPPAN
YQGNNYRPLLRGQAQIPKLMSNMRPQDSWRGPPPLFQQHRFERSVGAEPLLPWNRMIQNQ
NAAFQPNQYQMLGGPGGYPPRRDDHRGGRQGYPREGRKYPLPPPSGRYSWN
Download sequence
Identical sequences Q9DBR1
ENSMUSP00000028921 NP_036047.2.92730 10090.ENSMUSP00000028921 ENSMUSP00000028921 ENSMUSP00000028921

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]