SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000029078 from Mus musculus 69_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000029078
Domain Number 1 Region: 2-259
Classification Level Classification E-value
Superfamily Carbonic anhydrase 6.28e-100
Family Carbonic anhydrase 0.000000000883
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000029078   Gene: ENSMUSG00000027562   Transcript: ENSMUST00000029078
Sequence length 260
Comment pep:known chromosome:GRCm38:3:14886426:14900769:1 gene:ENSMUSG00000027562 transcript:ENSMUST00000029078 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSHHWGYSKHNGPENWHKDFPIANGDRQSPVDIDTATAQHDPALQPLLISYDKAASKSIV
NNGHSFNVEFDDSQDNAVLKGGPLSDSYRLIQFHFHWGSSDGQGSEHTVNKKKYAAELHL
VHWNTKYGDFGKAVQQPDGLAVLGIFLKIGPASQGLQKVLEALHSIKTKGKRAAFANFDP
CSLLPGNLDYWTYPGSLTTPPLLECVTWIVLREPITVSSEQMSHFRTLNFNEEGDAEEAM
VDNWRPAQPLKNRKIKASFK
Download sequence
Identical sequences P00920
ENSMUSP00000029078 ENSMUSP00000029078 ENSMUSP00000029078 NP_033931.4.92730 XP_006530113.1.92730 10090.ENSMUSP00000029078

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]