SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000029652 from Mus musculus 69_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000029652
Domain Number 1 Region: 55-162
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.1e-21
Family Spermadhesin, CUB domain 0.00079
Further Details:      
 
Domain Number 2 Region: 236-338
Classification Level Classification E-value
Superfamily Cystine-knot cytokines 9.85e-20
Family Platelet-derived growth factor-like 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000029652   Gene: ENSMUSG00000028019   Transcript: ENSMUST00000029652
Sequence length 345
Comment pep:known chromosome:GRCm38:3:81036416:81214040:1 gene:ENSMUSG00000028019 transcript:ENSMUST00000029652 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLLGLLLLTSALAGQRTGTRAESNLSSKLQLSSDKEQNGVQDPRHERVVTISGNGSIHS
PKFPHTYPRNMVLVWRLVAVDENVRIQLTFDERFGLEDPEDDICKYDFVEVEEPSDGSVL
GRWCGSGTVPGKQTSKGNHIRIRFVSDEYFPSEPGFCIHYSIIMPQVTETTSPSVLPPSS
LSLDLLNNAVTAFSTLEELIRYLEPDRWQVDLDSLYKPTWQLLGKAFLYGKKSKVVNLNL
LKEEVKLYSCTPRNFSVSIREELKRTDTIFWPGCLLVKRCGGNCACCLHNCNECQCVPRK
VTKKYHEVLQLRPKTGVKGLHKSLTDVALEHHEECDCVCRGNAGG
Download sequence
Identical sequences Q8CI19
ENSMUSP00000029652 10090.ENSMUSP00000029652 ENSMUSP00000029652 ENSMUSP00000029652 NP_064355.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]