SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000029674 from Mus musculus 69_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000029674
Domain Number 1 Region: 27-159
Classification Level Classification E-value
Superfamily Cupredoxins 3.77e-46
Family Ephrin ectodomain 0.0000177
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000029674   Gene: ENSMUSG00000028040   Transcript: ENSMUST00000029674
Sequence length 206
Comment pep:known chromosome:GRCm38:3:89333390:89338028:-1 gene:ENSMUSG00000028040 transcript:ENSMUST00000029674 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLLPLLRTVLWAALLGSRLPGCSSLRHPIYWNSSNPRLLRGDAVVELGFNDYLDIFCPH
YESPGPPEGPETFALYMVDWSGYEACTAEGANAFQRWNCSMPFAPFSPVRFSEKIQRYTP
FPLGFEFLPGETYYYISVPTPESPGRCLRLQVSVCCKESGSSHESAHPVGSPGESGTSGW
RGGHAPSPLCLLLLLLLPILRLLRVL
Download sequence
Identical sequences O08542 Q3UQB5
10090.ENSMUSP00000029674 ENSMUSP00000029674 NP_031936.2.92730 ENSMUSP00000029674 ENSMUSP00000029674

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]