SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000029806 from Mus musculus 69_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000029806
Domain Number 1 Region: 163-255
Classification Level Classification E-value
Superfamily PH domain-like 4.93e-29
Family Pleckstrin-homology domain (PH domain) 0.00000561
Further Details:      
 
Domain Number 2 Region: 31-131
Classification Level Classification E-value
Superfamily SH2 domain 7.94e-27
Family SH2 domain 0.00038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000029806   Gene: ENSMUSG00000028159   Transcript: ENSMUST00000029806
Sequence length 280
Comment pep:known chromosome:GRCm38:3:137931007:137981545:-1 gene:ENSMUSG00000028159 transcript:ENSMUST00000029806 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRAELLGGNMSTQDPSELWGRADGGTDLLQDLGWYHGNLTRHAAEALLLSNGRDGSYLL
RDSNEQTGLYSLSVRAKDSVKHFHVEYTGYSFKFGFNEYSSLKDFVKHFANQPLIGSETG
TLMVLKHPYPREVEEPCIYESVRVHTAMQTGRTENDLVPTAPSLGTKEGYLTKQGGLVKT
WKTRWFTLQRNELKYFKDQMSPEPIRILDLTECSAVQFDYSQERVNCFCLVFPFRTFYLC
AKTGVEADEWIKILRWKLSKIRKQLDQGEDTVRSRSFIFK
Download sequence
Identical sequences Q3UK44 Q9QXT1
10090.ENSMUSP00000029806 ENSMUSP00000029806 ENSMUSP00000029806 ENSMUSP00000029806 NP_036062.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]