SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000030122 from Mus musculus 69_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000030122
Domain Number 1 Region: 30-86
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000000132
Family Ovomucoid domain III-like 0.00061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000030122   Gene: ENSMUSG00000028415   Transcript: ENSMUST00000030122
Sequence length 86
Comment pep:known chromosome:GRCm38:4:40920052:40931395:1 gene:ENSMUSG00000028415 transcript:ENSMUST00000030122 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAMHLWLVTLTLVPLLGMDRELMVSAGSLVFPRMPFCEHMAELPNCPQTPNLICGTDGLT
YENECHLCLTRMKTMKDIQIMKDGQC
Download sequence
Identical sequences O35679
ENSMUSP00000030122 NP_035593.2.92730 10090.ENSMUSP00000030122 ENSMUSP00000030122 ENSMUSP00000030122

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]