SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000030817 from Mus musculus 69_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000030817
Domain Number 1 Region: 20-277
Classification Level Classification E-value
Superfamily Carbonic anhydrase 6.8e-80
Family Carbonic anhydrase 0.0000029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000030817   Gene: ENSMUSG00000028972   Transcript: ENSMUST00000030817
Sequence length 317
Comment pep:known chromosome:GRCm38:4:150187015:150201332:-1 gene:ENSMUSG00000028972 transcript:ENSMUST00000030817 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRALVSVVSLFFLGIQAHSDWSYSGDDGVGESQWSEQYPSCGGERQSPIDVKTEEVMFNP
SLKPLSLVNYEKENLEFTMTNNGHTVSIDLPPSMYLETSDGTEFISKAFHFHWGGRDWEL
SGSEHTIDGIRSIMEAHFVHFNKEYGTYENAKDQKNGLAVLAVLFKIDEYAENTYYSDII
SALKNIEKPGETTTLKDTTIRNLLPKDVHHYYTYPGSLTTPPCTENVQWFVLRDKVTLSK
AQVVTIENSVMDHNNNTIQNGYRSTQPNNHRVVEANFLNVQDMYSSYHLYLKNMQKEILQ
PKKQKKTKKNRHFWSRK
Download sequence
Identical sequences P18761
NP_033932.2.92730 ENSMUSP00000030817 ENSMUSP00000030817 ENSMUSP00000030817 10090.ENSMUSP00000030817

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]