SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000032704 from Mus musculus 69_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000032704
Domain Number 1 Region: 158-216
Classification Level Classification E-value
Superfamily RuvA domain 2-like 0.00000000000000604
Family Hef domain-like 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000032704   Gene: ENSMUSG00000030493   Transcript: ENSMUST00000032704
Sequence length 221
Comment pep:known chromosome:GRCm38:7:35392275:35396817:-1 gene:ENSMUSG00000030493 transcript:ENSMUST00000032704 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERNPPDGTGPVHVPLGHIVASEKWRGSQLAQEMQGKVRLIFEEGLASADFYLSSKSCIL
YVTEADLVAGHGYRKRLARFRNSSHLQGIIIVEKTQMSEQYFPAVQKFTVLDLGMVLLPV
ASQSEASCLIIHLVQEQTREPSKNPFLRKKRSMLSELSLVQTVQQIPGVGKVKAPLLLQK
FPSIQQLSNASVQELEEVVGPAAAQQIHTFFTQPKRQQPRS
Download sequence
Identical sequences Q8BHL6
ENSMUSP00000032704 NP_848758.1.92730 ENSMUSP00000032704 ENSMUSP00000115766 10090.ENSMUSP00000115766 ENSMUSP00000032704

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]