SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000033617 from Mus musculus 69_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000033617
Domain Number 1 Region: 383-648
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.89e-76
Family Protein kinases, catalytic subunit 0.000000000291
Further Details:      
 
Domain Number 2 Region: 4-168
Classification Level Classification E-value
Superfamily PH domain-like 1.57e-52
Family Pleckstrin-homology domain (PH domain) 0.0000000306
Further Details:      
 
Domain Number 3 Region: 251-378
Classification Level Classification E-value
Superfamily SH2 domain 6.26e-33
Family SH2 domain 0.000041
Further Details:      
 
Domain Number 4 Region: 200-273
Classification Level Classification E-value
Superfamily SH3-domain 6.12e-19
Family SH3-domain 0.0000252
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000033617   Gene: ENSMUSG00000031264   Transcript: ENSMUST00000033617
Sequence length 659
Comment pep:known chromosome:GRCm38:X:134542336:134583140:-1 gene:ENSMUSG00000031264 transcript:ENSMUST00000033617 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAVILESIFLKRSQQKKKTSPLNFKKRLFLLTVHKLSYYEYDFERGRRGSKKGSIDVEK
ITCVETVIPEKNPPPERQIPRRGEESSEMEQISIIERFPYPFQVVYDEGPLYVFSPTEEL
RKRWIHQLKNVIRYNSDLVQKYHPCFWIDGQYLCCSQTAKNAMGCQILENRNGSLKPGSS
HRKTKKPLPPTPEEDQILKKPLPPEPTAAPISTTELKKVVALYDYMPMNANDLQLRKGEE
YFILEESNLPWWRARDKNGQEGYIPSNYITEAEDSIEMYEWYSKHMTRSQAEQLLKQEGK
EGGFIVRDSSKAGKYTVSVFAKSTGEPQGVIRHYVVCSTPQSQYYLAEKHLFSTIPELIN
YHQHNSAGLISRLKYPVSKQNKNAPSTAGLGYGSWEIDPKDLTFLKELGTGQFGVVKYGK
WRGQYDVAIKMIREGSMSEDEFIEEAKVMMNLSHEKLVQLYGVCTKQRPIFIITEYMANG
CLLNYLREMRHRFQTQQLLEMCKDVCEAMEYLESKQFLHRDLAARNCLVNDQGVVKVSDF
GLSRYVLDDEYTSSVGSKFPVRWSPPEVLMYSKFSSKSDIWAFGVLMWEIYSLGKMPYER
FTNSETAEHIAQGLRLYRPHLASERVYTIMYSCWHEKADERPSFKILLSNILDVMDEES
Download sequence
Identical sequences P35991
ENSMUSP00000033617 ENSMUSP00000033617 10090.ENSMUSP00000033617 NP_038510.2.92730 XP_006528546.1.92730 XP_006528547.1.92730 XP_006528548.1.92730 ENSMUSP00000033617

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]