SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000033739 from Mus musculus 69_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000033739
Domain Number 1 Region: 49-296
Classification Level Classification E-value
Superfamily Carbonic anhydrase 3.53e-92
Family Carbonic anhydrase 0.0000000116
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000033739   Gene: ENSMUSG00000031373   Transcript: ENSMUST00000033739
Sequence length 317
Comment pep:known chromosome:GRCm38:X:163976822:164027997:-1 gene:ENSMUSG00000031373 transcript:ENSMUST00000033739 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVMNHLRVILQVSSSTLPWRRCWVPRLVPRRSCSLYTCTYRTRNRALPPLWENLDLVPA
GDRQSPINIRWRDSVYDPGLKPLTISYDPATCLHIWNNGYSFLVEFEDSTDKSVVEGGPL
EHNYRLKQFHFHWGAIDAWGSEHTVDSKCYPAELHLVHWNAVKFESFEDAALEENGLAVI
GVFLKLGKHHKELQKLVDTLPSIKHKDTLVEFGSFDPSCLMPTCPDYWTYSGSLTTPPLS
ESVTWIIKKQPVEVDRDQLEQFRTLLFTSEGEKEKRMVDNFRPLQPLMNRTVRSSFRHDY
VLNIQVKPKPTASEVTP
Download sequence
Identical sequences Q9QZA0
10090.ENSMUSP00000033739 ENSMUSP00000033739 ENSMUSP00000033739 NP_851832.2.92730 ENSMUSP00000033739

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]