SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000033927 from Mus musculus 69_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000033927
Domain Number 1 Region: 121-317
Classification Level Classification E-value
Superfamily Ribonuclease H-like 7.42e-41
Family DnaQ-like 3'-5' exonuclease 0.00000000724
Further Details:      
 
Domain Number 2 Region: 72-108
Classification Level Classification E-value
Superfamily SAP domain 0.0000847
Family SAP domain 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000033927   Gene: ENSMUSG00000031527   Transcript: ENSMUST00000033927
Sequence length 345
Comment pep:known chromosome:GRCm38:8:35465265:35495533:-1 gene:ENSMUSG00000031527 transcript:ENSMUST00000033927 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEDERGRERGGDAAQQKTPRPECEESRPLSVEKKQRCRLDGKETDGSKFISSNGSDFSDP
VYKEIAMTNGCINRMSKEELRAKLSEFKLETRGVKDVLKKRLKNYYKKQKLMLKESSAGD
SYYDYICIIDFEATCEEGNPAEFLHEIIEFPVVLLNTHTLEIEDTFQQYVRPEVNDQLSE
FCIGLTGITQDQVDRADAFPQVLKKVIEWMKSKELGTKYKYCILTDGSWDMSKFLSIQCR
LSRLKHPAFAKKWINIRKSYGNFYKVPRSQTKLTIMLEKLGMDYDGRPHSGLDDSKNIAR
IAIRMLQDGCELRINEKILGGQLMSVSSSLPVEGAPAPQMPHSRK
Download sequence
Identical sequences A0A0R4J0C8
ENSMUSP00000033927 ENSMUSP00000033927 NP_080343.4.92730 10090.ENSMUSP00000033927 ENSMUSP00000033927

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]