SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000034296 from Mus musculus 69_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000034296
Domain Number 1 Region: 608-712
Classification Level Classification E-value
Superfamily SH2 domain 7.27e-32
Family SH2 domain 0.00000331
Further Details:      
 
Domain Number 2 Region: 317-421
Classification Level Classification E-value
Superfamily SH2 domain 2.15e-29
Family SH2 domain 0.00000234
Further Details:      
 
Domain Number 3 Region: 113-261
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 0.0000000000000883
Family BCR-homology GTPase activation domain (BH-domain) 0.00051
Further Details:      
 
Domain Number 4 Region: 5-82
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000000177
Family SH3-domain 0.000097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000034296   Gene: ENSMUSG00000031834   Transcript: ENSMUST00000034296
Sequence length 722
Comment pep:known chromosome:GRCm38:8:70768176:70776713:-1 gene:ENSMUSG00000031834 transcript:ENSMUST00000034296 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGAEGFQYRAVYPFRRERPEDLELLPGDLLVVSRVALQALGVADGGERCPHNVGWMPGF
NERTRQRGDFPGTYVEFLGPVALARPGPRPRGPRPLPARPLDGSSESGHILPDLAEQFSP
PDPAPPILVKLVEAIEQAELDSECYSKPELPATRTDWSLSDLEQWDRTALYDAVKGFLLA
LPAAVVTPEAAAEAYRALREVAGPVGLVLEPPTLPLHQALTLRFLLQHLGRVARRAPSPD
TAVHALASAFGPLLLRIPPSGGEGDGSEPVPDFPVLLLERLVQEHVEEQDAAPPALPPKP
SKAKPAPTALANGGSPPSLQDAEWYWGDISREEVNERLRDTPDGTFLVRDASSKIQGEYT
LTLRKGGNNKLIKVFHRDGHYGFSEPLTFCSVVELISHYRHESLAQYNAKLDTRLLYPVS
KYQQDQVVKEDSIEAVGAQLKVYHQQYQDKSREYDQLYEEYTRTSQELQMKRTAIEAFNE
TIKIFEEQGQTQEKCSKEYLERFRREGNEKEMQRILLNSERLKSRIAEIHESRTKLEQDL
RAQASDNREIDKRMNSLKPDLMQLRKIRDQYLVWLTQKGARQRKINEWLGIKNETEDQYS
LMEDEDALPHHEERTWYVGKINRTQAEEMLSGKRDGTFLIRESSQRGCYACSVVVDGDTK
HCVIYRTATGFGFAEPYNLYGSLKELVLHYQHASLVQHNDALTVTLAHPVRAPGPGPPSA
AR
Download sequence
Identical sequences O08908
ENSMUSP00000034296 10090.ENSMUSP00000034296 ENSMUSP00000034296 ENSMUSP00000034296 NP_032867.2.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]