SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000034763 from Mus musculus 69_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMUSP00000034763
Domain Number - Region: 92-120
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00419
Family Retrovirus zinc finger-like domains 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000034763   Gene: ENSMUSG00000032239   Transcript: ENSMUST00000034763
Sequence length 213
Comment pep:known chromosome:GRCm38:9:22448311:22468356:-1 gene:ENSMUSG00000032239 transcript:ENSMUST00000034763 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSGAGSRRPREPPEHELQRRREQKRRRHDAQQLQQLKHLESFYEKPPPGFIKEDETKPE
DCIPDVPGNEHAREFLAHAPTKGLWMPLGREVKVMQCWRCKRYGHRTGDKECPFFIKGNQ
KLEQFRVAHEDPMYDIIRENKRHEKDVRIQQLKQLLEDSTSDDDGSSSSSSGDREKRKKR
KKKEKHKKRKKEKKKKKKRKHKASKSSESSDSE
Download sequence
Identical sequences P97762 Q3TH81
NP_061209.1.92730 ENSMUSP00000034763 ENSMUSP00000034763 10090.ENSMUSP00000034763

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]