SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000036974 from Mus musculus 69_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000036974
Domain Number 1 Region: 146-254
Classification Level Classification E-value
Superfamily Immunoglobulin 1.69e-18
Family I set domains 0.047
Further Details:      
 
Domain Number 2 Region: 28-111
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000127
Family Growth factor receptor domain 0.0019
Further Details:      
 
Domain Number 3 Region: 98-143
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000374
Family Ovomucoid domain III-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000036974   Gene: ENSMUSG00000035551   Transcript: ENSMUST00000044297
Sequence length 270
Comment pep:known chromosome:GRCm38:4:45809468:45826923:-1 gene:ENSMUSG00000035551 transcript:ENSMUST00000044297 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRLPLLLLLLPSLARGLGLRDAGRRHPECSPCQQDRCPAPSPCPAPWISARDECGCCAR
CLGAEGASCGGPVGSRCGPGLVCASRASGTAPEGTGLCVCAQRGAVCGSDGRSYSSICAL
RLRARHAPRAHHGHLHKARDGPCEFAPVVLMPPRDIHNVTGTQVFLSCEVKAVPTPVITW
KKVKHSPEGTEGLEELPGDHVNIAVQVRGGPSDHETTSWILINPLRKEDEGVYHCHAANA
IGEAQSHGTVTVLDLNRYKSLYSSVPGDLL
Download sequence
Identical sequences Q80W15
ENSMUSP00000036974 NYSGRC-IgSF-Q80W15 NP_061211.1.92730 10090.ENSMUSP00000036974 ENSMUSP00000036974 ENSMUSP00000036974

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]