SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000036983 from Mus musculus 69_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000036983
Domain Number 1 Region: 20-278
Classification Level Classification E-value
Superfamily Carbonic anhydrase 1.44e-91
Family Carbonic anhydrase 0.0000000000889
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000036983   Gene: ENSMUSG00000038526   Transcript: ENSMUST00000036181
Sequence length 337
Comment pep:known chromosome:GRCm38:3:95897768:95904691:-1 gene:ENSMUSG00000038526 transcript:ENSMUST00000036181 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLFFALLLKVTWILAADGGHHWTYEGPHGQDHWPTSYPECGGDAQSPINIQTDSVIFDPD
LPAVQPHGYDQLGTEPLDLHNNGHTVQLSLPPTLHLGGLPRKYTAAQLHLHWGQRGSLEG
SEHQINSEATAAELHVVHYDSQSYSSLSEAAQKPQGLAVLGILIEVGETENPAYDHILSR
LHEIRYKDQKTSVPPFSVRELFPQQLEQFFRYNGSLTTPPCYQSVLWTVFNRRAQISMGQ
LEKLQETLSSTEEDPSEPLVQNYRVPQPLNQRTIFASFIQAGPLYTTGEMLGLGVGILAG
CLCLLLAVYFIAQKIRKKRLGNRKSVVFTSARATTEA
Download sequence
Identical sequences Q9WVT6
ENSMUSP00000036983 ENSMUSP00000036983 ENSMUSP00000036983 NP_035927.1.92730 10090.ENSMUSP00000036983

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]