SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000038591 from Mus musculus 69_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000038591
Domain Number 1 Region: 370-474
Classification Level Classification E-value
Superfamily SH2 domain 6.33e-26
Family SH2 domain 0.00000133
Further Details:      
 
Domain Number 2 Region: 482-523
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000000000000981
Family SOCS box-like 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000038591   Gene: ENSMUSG00000037104   Transcript: ENSMUST00000041369
Sequence length 536
Comment pep:known chromosome:GRCm38:17:87107679:87137583:1 gene:ENSMUSG00000037104 transcript:ENSMUST00000041369 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDKVGKMWNNLKYRCQNLFSHEGGSRNENVEMNPNRCPSVKEKSISLGEAAPQQESSPLR
ENVALQLGLSPSKTFSRRNQNCAAEIPQVVEISIEKDSDSGATPGTRLARRDSYSRHAPW
GGKKKHSCSTKTQSSLDTEKKFGRTRSGLQRRERRYGVSSMQDMDSVSSRAVGSRSLRQR
LQDTVGLCFPMRTYSKQSKPLFSNKRKIHLSELMLEKCPFPAGSDLAQKWHLIKQHTAPV
SPHSTFFDTFDPSLVSTEDEEDRLRERRRLSIEEGVDPPPNAQIHTFEATAQVNPLYKLG
PKLAPGMTEISGDGSAIPQTNCDSEEDSTTLCLQSRRQKQRQVSGDSHAHVSRQGAWKVH
TQIDYIHCLVPDLLQITGNPCYWGVMDRYEAEALLEGKPEGTFLLRDSAQEDYLFSVSFR
RYNRSLHARIEQWNHNFSFDAHDPCVFHSSTVTGLLEHYKDPSSCMFFEPLLTISLNRTF
PFSLQYICRAVICRCTTYDGIDGLPLPSMLQDFLKEYHYKQKVRVRWLEREPVKAK
Download sequence
Identical sequences O54928
NP_062628.2.92730 XP_006524734.1.92730 XP_006524735.1.92730 XP_006524737.1.92730 XP_006524738.1.92730 ENSMUSP00000038591 ENSMUSP00000038591 ENSMUSP00000038591 10090.ENSMUSP00000038591

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]