SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000041227 from Mus musculus 69_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000041227
Domain Number 1 Region: 200-545,624-648
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.66e-83
Family Myotubularin-like phosphatases 0.0000414
Further Details:      
 
Domain Number 2 Region: 43-187
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000000221
Family GRAM domain 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000041227   Gene: ENSMUSG00000039458   Transcript: ENSMUST00000038172
Sequence length 747
Comment pep:known chromosome:GRCm38:15:12205028:12272240:1 gene:ENSMUSG00000039458 transcript:ENSMUST00000038172 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLGKGGVGGGGGTKAPKPSFVSYVRPEEIHTDEKEVTEKEVTLHLLPGEQLLCEASTVLK
YVQEDSCQRGVYGRLVCTDFKISFLGDEDSALDNGGEAQFKNKIIGVNDVPLHCVDQIYG
VFDEKKKPLFGQLKKYPEKLVIHCKDLRVLHFCLRYTKEEEVKRIVSGIIHHTQSPKLLK
RLFLFSYAAAVHGTATDSRNCTVMFDTPKDWCWELERTKGSVKYRTVSVNEGYRVSDRLP
AYFVVPTPLPEDDVRRFQGHGIPIWCWSCHNGSALLKMSALPKEQDDGALQVQKSFLDGI
YKTIHRPPYEMVKTEDLSSNFLSLQEIQSAYCKFKQLFLIDNSSEFWDTDIKWFSLLESS
SWLDIIRRCLKKAIEITECLEAQNVNVLLLEENASDLCCLLSSLVQVMMDAHCRTRTGFQ
SLIQKEWVMGGHSFLDRCNHLHQSDKEEVPIFLLFLDCVWQLVHQYPPAFEFTETYLTVL
SDSLYIPIFSTFFFNSPHQKDTNMGRENLDAQSKPLTLLTVWDWSVQFEPKAQTLLRNPL
YVEKPKLDRGQQKGSRFKHQRQLSLPLTQSKSSPKRGFFREETDHLIKNLLGKRISKLIN
SSDDLQDSSREFYDSWHSKPTDYHGLLLPHIEGPEIKVWAQRYLRWIPEAQILGGGRVAT
MGKLLEMMEEVQSLQEKIEARHHRQEAVHAEAPGLLRNSVRLSSLFPFALLQRHSAKPVL
PTSGWKALGGEDDLAKREDEFVDLGDV
Download sequence
Identical sequences Q80TA6
ENSMUSP00000041227 NP_766546.1.92730 ENSMUSP00000041227 10090.ENSMUSP00000041227 ENSMUSP00000041227

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]