SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000041902 from Mus musculus 69_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000041902
Domain Number 1 Region: 47-175
Classification Level Classification E-value
Superfamily N-terminal domain of cbl (N-cbl) 2.75e-58
Family N-terminal domain of cbl (N-cbl) 0.000000183
Further Details:      
 
Domain Number 2 Region: 262-348
Classification Level Classification E-value
Superfamily SH2 domain 2.09e-48
Family SH2 domain 0.00000221
Further Details:      
 
Domain Number 3 Region: 354-432
Classification Level Classification E-value
Superfamily RING/U-box 8.39e-43
Family RING finger domain, C3HC4 0.00000878
Further Details:      
 
Domain Number 4 Region: 176-261
Classification Level Classification E-value
Superfamily EF-hand 2.14e-38
Family EF-hand modules in multidomain proteins 0.00000543
Further Details:      
 
Domain Number 5 Region: 862-900
Classification Level Classification E-value
Superfamily UBA-like 0.00000383
Family UBA domain 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000041902   Gene: ENSMUSG00000034342   Transcript: ENSMUST00000037644
Sequence length 913
Comment pep:known chromosome:GRCm38:9:44149262:44234046:-1 gene:ENSMUSG00000034342 transcript:ENSMUST00000037644 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGNVKKSSGAGGGGSGGSGAGGLIGLMKDAFQPHHHHHHLSPHPPCTVDKKMVEKCWKL
MDKVVRLCQNPKLALKNSPPYILDLLPDTYQHLRTVLSRYEGKMETLGENEYFRVFMENL
MKKTKQTISLFKEGKERMYEENSQPRRNLTKLSLIFSHMLAELKGIFPSGLFQGDTFRIT
KADAAEFWRKAFGEKTIVPWKSFRQALHEVHPISSGLEAMALKSTIDLTCNDYISVFEFD
IFTRLFQPWSSLLRNWNSLAVTHPGYMAFLTYDEVKARLQKFIHKPGSYIFRLSCTRLGQ
WAIGYVTADGNILQTIPHNKPLFQALIDGFREGFYLFPDGRNQNPDLTGLCEPTPQDHIK
VTQEQYELYCEMGSTFQLCKICAENDKDVKIEPCGHLMCTSCLTSWQESEGQGCPFCRCE
IKGTEPIVVDPFDPRGSGSLLRQGAEGAPSPNYDDDDDERADDSLFMMKELAGAKVERPS
SPFSMAPQASLPPVPPRLDLLQQRAPVPASTSVLGTASKAASGSLHKDKPLPIPPTLRDL
PPPPPPDRPYSVGAETRPQRRPLPCTPGDCPSRDKLPPVPSSRPGDSWLSRPIPKVPVAT
PNPGDPWNGRELTNRHSLPFSLPSQMEPRADVPRLGSTFSLDTSMTMNSSPVAGPESEHP
KIKPSSSANAIYSLAARPLPMPKLPPGEQGESEEDTEYMTPTSRPVGVQKPEPKRPLEAT
QSSRACDCDQQIDSCTYEAMYNIQSQALSVAENSASGEGNLATAHTSTGPEESENEDDGY
DVPKPPVPAVLARRTLSDISNASSSFGWLSLDGDPTNFNEGSQVPERPPKPFPRRINSER
KASSYQQGGGATANPVATAPSPQLSSEIERLMSQGYSYQDIQKALVIAHNNIEMAKNILR
EFVSISSPAHVAT
Download sequence
Identical sequences P22682
ENSMUSP00000041902 NP_031645.2.92730 ENSMUSP00000041902 10090.ENSMUSP00000041902 ENSMUSP00000041902

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]