SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000042578 from Mus musculus 69_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000042578
Domain Number 1 Region: 53-174
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000000194
Family Spermadhesin, CUB domain 0.006
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000042578
Domain Number - Region: 181-288
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0432
Family Spermadhesin, CUB domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000042578   Gene: ENSMUSG00000021680   Transcript: ENSMUST00000045583
Sequence length 322
Comment pep:known chromosome:GRCm38:13:95431371:95444831:-1 gene:ENSMUSG00000021680 transcript:ENSMUST00000045583 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSPNFKLQCHFILILLTALRGESRYLEVQEAAVYDPLLLFSANLKRDLAEEQPYRRALRC
LDMLSLPGQFTFTADRPQLHCAAFFIGEPEEFITIHYDLVSIDCQGGDFLKVFDGWILKG
EKFPSSQDHPLPTMKRYTDFCESGLTRRSIRSSQNVAMVFFRVHEPGNGFTITIKTDPNL
FPCNVISQTPSGRFTLVVPYQHQNCSFSIIYPVAIKISDLTLGHLHGLQLKKPAAGCGGT
GDFVELLGGTGLDPSKMMPLADLCYPFLGPAQMKISCDNAVVRMVSSGKHINRVTFEYRQ
LEPFELETSTGNSIPEYCLSSL
Download sequence
Identical sequences Q3UY07 Q60571
ENSMUSP00000042578 10090.ENSMUSP00000042578 NP_940800.1.92730 ENSMUSP00000042578 ENSMUSP00000042578

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]