SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000044550 from Mus musculus 69_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMUSP00000044550
Domain Number - Region: 329-367
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000293
Family Retrovirus zinc finger-like domains 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000044550   Gene: ENSMUSG00000036699   Transcript: ENSMUST00000048067
Sequence length 402
Comment pep:known chromosome:GRCm38:X:36195946:36199158:1 gene:ENSMUSG00000036699 transcript:ENSMUST00000048067 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASILSRLGSSRGQNSPLPPWAHSMLRSLGRSLGPLMASMAERNMRLFSGRAEPAQGEET
FENWLSQVTGVLPDWHMPEEEKVRRLMRTLRGPAREVMRLLQAANPGLDVEDFLRAMKLV
FGESESSVTAHSKFVNTVQEHGEKPSLYVIRLEVQLQNAIQAGVFAEREANQARLHQLLV
GAEMSTDLRFRLKNLLRVYANEPERLPNFLELIRMIREEEEWEETFINPKRPRRAESVME
RALSPMAFQSSPPIMISSIDCNVIEIDDSPDDSDEDVILVEPEDPPLPSSSASSFLGRAV
SEDQVLVIESPNIFEIQAPSTSSGAGRKNNRGFGELRRARKRKHTIHCSHCGEEGHSKET
CDNESDKGQVFENLIITLQELTHAEERARGAPGEPIGLSEPQ
Download sequence
Identical sequences Q9CZA5
10090.ENSMUSP00000110911 ENSMUSP00000044550 ENSMUSP00000044550 NP_082601.1.92730 XP_006541458.1.92730 XP_006541460.1.92730 XP_006541461.1.92730 XP_006541462.1.92730 XP_006541463.1.92730 XP_006541464.1.92730 XP_006541466.1.92730 XP_011249276.1.92730 XP_017174118.1.92730 XP_017174119.1.92730 ENSMUSP00000044550 ENSMUSP00000110911 ENSMUSP00000110912 ENSMUSP00000110913

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]