SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000046987 from Mus musculus 69_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000046987
Domain Number 1 Region: 55-99
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000015
Family EGF-type module 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000046987   Gene: ENSMUSG00000035020   Transcript: ENSMUST00000041516
Sequence length 152
Comment pep:known chromosome:GRCm38:5:91027464:91035215:1 gene:ENSMUSG00000035020 transcript:ENSMUST00000041516 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALGVLIAVCLLFKAMKAALSEEAEVIPPSTAQQSNWTFNNTEADYIEEPVALKFSHPCL
EDHNSYCINGACAFHHELKQAICRCFTGYTGQRCEHLTLTSYAVDSYEKYIAIGIGVGLL
ISAFLAVFYCYIRKRCINLKSPYIICSGGSPL
Download sequence
Identical sequences Q0VEB7 Q924X1
ENSMUSP00000046987 NP_444317.1.92730 10090.ENSMUSP00000046987 ENSMUSP00000046987 ENSMUSP00000046987

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]