SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000049834 from Mus musculus 69_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMUSP00000049834
Domain Number - Region: 116-145
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00251
Family Retrovirus zinc finger-like domains 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000049834   Gene: ENSMUSG00000041777   Transcript: ENSMUST00000058615
Sequence length 450
Comment pep:known chromosome:GRCm38:2:73283105:73312701:-1 gene:ENSMUSG00000041777 transcript:ENSMUST00000058615 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGKSFANFMCKKDFHPASKSNIKKVWMAEQKISYDKKKQEELMQQYLKEQESYDNRLLMG
DERVKNGLNFMYEAPPGVKKENKEKEETEGETEYKFEWQKGAPREKYAKDDMNIRDQPFG
IQVRNVRCIKCHKWGHVNTDRECPLFGLSGINASSVPTDGSGPSMHPSELIAEMRNSGFA
LKRNVLGRNLTANDPSQDYVASDCEEDPEVEFLKSLTTKQKQKLLRKLDRLEKKKKKKKS
DKKKKKLQKSKNKHKKRKNKSPSSSSSSSSSSSSSSSSSSSSSSSSETSDSSSESDNKEK
KREKEKRKKKKKTKCSESKSSDCKEDKPKNMLYEELSSSHSDRGKAQEKLRFPKQESSGE
NSMWVHSASDRTSRSHRHSPEKKGSDRNRGIRSRSRSRAESSRRSRSRSPYRQKHREVRS
RPHRSPSEEQKGRKGTRSHGEGDHRREHVR
Download sequence
Identical sequences Q9DA19
10090.ENSMUSP00000049834 ENSMUSP00000049834 ENSMUSP00000049834 NP_080130.2.92730 ENSMUSP00000049834

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]