SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000053238 from Mus musculus 69_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000053238
Domain Number 1 Region: 427-562
Classification Level Classification E-value
Superfamily TIMP-like 2.67e-31
Family Netrin-like domain (NTR/C345C module) 0.033
Further Details:      
 
Domain Number 2 Region: 204-299
Classification Level Classification E-value
Superfamily Immunoglobulin 1.12e-20
Family I set domains 0.036
Further Details:      
 
Domain Number 3 Region: 380-432
Classification Level Classification E-value
Superfamily BPTI-like 4.68e-20
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0021
Further Details:      
 
Domain Number 4 Region: 319-375
Classification Level Classification E-value
Superfamily BPTI-like 5.96e-16
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.016
Further Details:      
 
Domain Number 5 Region: 118-168
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000901
Family Ovomucoid domain III-like 0.033
Further Details:      
 
Domain Number 6 Region: 32-83
Classification Level Classification E-value
Superfamily Elafin-like 0.000000144
Family Elafin-like 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000053238   Gene: ENSMUSG00000044177   Transcript: ENSMUST00000061469
Sequence length 571
Comment pep:known chromosome:GRCm38:11:94235956:94242707:-1 gene:ENSMUSG00000044177 transcript:ENSMUST00000061469 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCAPGYHRFWFHWGLLLLLLLEAPLRGLALPPIRYSHAGICPNDMNPNLWVDAQSTCKRE
CETDQECETYEKCCPNVCGTKSCVAARYMDVKGKKGPVGMPKEATCDHFMCLQQGSECDI
WDGQPVCKCKDRCEKEPSFTCASDGLTYYNRCFMDAEACSKGITLSVVTCRYHFTWPNTS
PPPPETTVHPTTASPETLGLDMAAPALLNHPVHQSVTVGETVSFLCDVVGRPRPELTWEK
QLEDRENVVMRPNHVRGNVVVTNIAQLVIYNVQPQDAGIYTCTARNVAGVLRADFPLSVV
RGGQARATSESSLNGTAFPATECLKPPDSEDCGEEQTRWHFDAQANNCLTFTFGHCHHNL
NHFETYEACMLACMSGPLAICSLPALQGPCKAYVPRWAYNSQTGLCQSFVYGGCEGNGNN
FESREACEESCPFPRGNQHCRACKPRQKLVTSFCRSDFVILGRVSELTEEQDSGRALVTV
DEVLKDEKMGLKFLGREPLEVTLLHVDWTCPCPNVTVGETPLIIMGEVDGGMAMLRPDSF
VGASSTRRVRKLREVMYKKTCDVLKDFLGLQ
Download sequence
Identical sequences Q7TQN3
10090.ENSMUSP00000053238 ENSMUSP00000053238 NP_861540.2.92730 XP_006533561.1.92730 XP_006533562.1.92730 XP_006533563.1.92730 XP_006533564.1.92730 XP_006533565.1.92730 XP_011247365.1.92730 NYSGRC-IgSF-Q7TQN3 ENSMUSP00000053238 ENSMUSP00000053238

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]