SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Home > Genomes > Mus musculus 69_38 > ENSMUSP00000054134

Domain assignment for ENSMUSP00000054134 from Mus musculus 69_38

Domain architecture

Domain assignment details

(show help)
Strong hits

Sequence:	ENSMUSP00000054134
Domain Number 1	Region: 29-65
Classification Level	Classification	E-value
Superfamily	LDL receptor-like module	0.0000000000262
Family	LDL receptor-like module	0.0011
Further Details:

Domain Number 2	Region: 70-107
Classification Level	Classification	E-value
Superfamily	LDL receptor-like module	0.000000000484
Family	LDL receptor-like module	0.0015
Further Details:

Domain Number 3	Region: 110-147
Classification Level	Classification	E-value
Superfamily	LDL receptor-like module	0.000000000511
Family	LDL receptor-like module	0.0012
Further Details:

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by

Molecular Function
Biological Process
Cellular Component

Cellular Component	IC (bits)	H-Score

Biological Process	IC (bits)	H-Score

Molecular Function	IC (bits)	H-Score

Protein sequence

External link(s)	Protein: ENSMUSP00000054134 Gene: ENSMUSG00000048058 Transcript: ENSMUST00000058790
Sequence length	345
Comment	pep:known chromosome:GRCm38:2:101950203:102186385:-1 gene:ENSMUSG00000048058 transcript:ENSMUST00000058790 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence	MWLLGPLCLLLSSTAESQLLPGNNFTNECNIPGNFMCSNGRCIPGAWQCDGLPDCFDKSD EKECPKAKSKCGPTFFPCASGIHCIIGRFRCNGFEDCPDGSDEENCTANPLLCSTARYHC RNGLCIDKSFICDGQNNCQDNSDEESCESSLEPGSGQVFVTSENQLVYYPSITYAIIGSS VIFVLVVALLALVLHHQRKRNNLMTLPVHRLQHPVLLSRLVVLDHPHHCNVTYNVNNGVQ YVATQAEQNASEVGSPPSYSEALLDQRPAWYDLPPPPYSSDTESLNQADLPPYRSRSGSA YSASSQAASSLLSVEASSHNPEQPGSPEGSAEPRDSVPSQGTEEV
Download sequence
Identical sequences	A2AR95 B2RR20 10090.ENSMUSP00000054134 ENSMUSP00000054134 NP_849217.2.92730 ENSMUSP00000054134 ENSMUSP00000054134

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]