SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000054177 from Mus musculus 69_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMUSP00000054177
Domain Number - Region: 409-436
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000133
Family Retrovirus zinc finger-like domains 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000054177   Gene: ENSMUSG00000046287   Transcript: ENSMUST00000060418
Sequence length 466
Comment pep:known chromosome:GRCm38:X:73064787:73068190:1 gene:ENSMUSG00000046287 transcript:ENSMUST00000060418 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLNLLQDWCRGEHLNTQRSMLILGIPEDCSEDEFEETLHEALKHLGRYRIIGRMFRREE
NAQAFLVELARDFDYALVPREIEGKGGPWEVVVKPPHSDDEFLNRLNHFLEEERRTVSDM
NRVLGTHSNHSPTKTTISADFWVWAQTLGAVMQPLLEQMLYRELRVFSGNTISIPGLLAF
DSWLEHTTEMLQMWQVPEVEKRRRLMECLRGPALQVVNVLRANNAAITVKECLEALRQVF
GSVDNRKIAQLKFCKAYQEPGEKVSSFVVRLETLLQKALEKNAISRKNVNQTRLKRILGG
AILSAKLREKLKMLKQRRRPPGFLALVKLFREEEEEWEATRGSERSCYEGLELGPSPSNI
GSEERELFVPAFGSVLEERPYQGSRRRRHRRRGQHRKGGVPRDDSQGTRKQNYDTFCYSC
GEDGHIRVHCFNPSNRTLVKQKRQAAMEKGNRSWAWEKSHPKPKTK
Download sequence
Identical sequences Q8JZW8
ENSMUSP00000054177 NP_694809.1.92730 ENSMUSP00000054177 10090.ENSMUSP00000054177 ENSMUSP00000054177

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]