SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000057781 from Mus musculus 69_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000057781
Domain Number 1 Region: 36-96
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000000596
Family Ovomucoid domain III-like 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000057781   Gene: ENSMUSG00000051050   Transcript: ENSMUST00000060328
Sequence length 96
Comment pep:known chromosome:GRCm38:18:44027869:44032208:1 gene:ENSMUSG00000051050 transcript:ENSMUST00000060328 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVKYFQCSVLFSIMLHLVILAAPGARVWWPTHGLIKIKCPYKKVNLSWFNKTVDPCPDLK
QPICGTNFVTYDNPCILCVESLKSGGRIRYYYNGRC
Download sequence
Identical sequences B9EJP9
NP_001034307.2.92730 10090.ENSMUSP00000057781 ENSMUSP00000057781 ENSMUSP00000057781 ENSMUSP00000125319 ENSMUSP00000057781

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]