SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000059129 from Mus musculus 69_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000059129
Domain Number 1 Region: 32-129
Classification Level Classification E-value
Superfamily SH2 domain 3.5e-23
Family SH2 domain 0.00027
Further Details:      
 
Domain Number 2 Region: 176-223
Classification Level Classification E-value
Superfamily SOCS box-like 0.000000000536
Family SOCS box-like 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000059129   Gene: ENSMUSG00000053113   Transcript: ENSMUST00000054002
Sequence length 225
Comment pep:known chromosome:GRCm38:11:117966079:117969186:-1 gene:ENSMUSG00000053113 transcript:ENSMUST00000054002 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVTHSKFPAAGMSRPLDTSLRLKTFSSKSEYQLVVNAVRKLQESGFYWSAVTGGEANLLL
SAEPAGTFLIRDSSDQRHFFTLSVKTQSGTKNLRIQCEGGSFSLQSDPRSTQPVPRFDCV
LKLVHHYMPPPGTPSFSLPPTEPSSEVPEQPPAQALPGSTPKRAYYIYSGGEKIPLVLSR
PLSSNVATLQHLCRKTVNGHLDSYEKVTQLPGPIREFLDQYDAPL
Download sequence
Identical sequences O35718
NP_031733.1.92730 XP_011247009.1.92730 XP_021068862.1.100879 ENSMUSP00000059129 GO.34547 ENSMUSP00000059129 10090.ENSMUSP00000059129 ENSMUSP00000059129

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]